DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH54F and mespbb

DIOPT Version :9

Sequence 1:NP_477302.1 Gene:HLH54F / 37027 FlyBaseID:FBgn0022740 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_001252536.1 Gene:mespbb / 100148845 ZFINID:ZDB-GENE-110609-1 Length:244 Species:Danio rerio


Alignment Length:195 Identity:51/195 - (26%)
Similarity:71/195 - (36%) Gaps:52/195 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SPTEFFDDDFDEDASSQS---------------------------SQPPVQRNAANARERMRMRV 46
            ||:.:.  ||...|.:||                           ..|..||.:|:.:|::|||.
Zfish    32 SPSSYM--DFSPSAQAQSVSPKPEISGSSFQDGGRSRVGVRRTRCKNPSKQRQSASEKEKLRMRD 94

  Fly    47 LSSAYGRLKTKLPN--IPPDTKLSKLDTLRLATLYIKQLITAVETGSHS------------QNHP 97
            |:.|...|:|.||.  .|....|:|::||||...||..|...:.....|            |..|
Zfish    95 LTKALHHLRTYLPPSVAPVGQTLTKIETLRLTIRYISYLSAQLGLSEESLCKMRDLRVSGYQEMP 159

  Fly    98 HNHNQHHSLNHSHSSTTSSEGLDTSHMADSSGGGNYNFHNNGHGMSWPF---EFHQSSRSLAFAP 159
            .||  .:|......|..:|.|...|.:..:.......|    .||..|.   .|:.||.||..:|
Zfish   160 QNH--CYSTAEFWGSCQNSCGTSESVLRRTDMDCRQVF----MGMEKPAYDDSFNSSSESLLESP 218

  Fly   160  159
            Zfish   219  218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH54FNP_477302.1 HLH 32..83 CDD:278439 22/52 (42%)
mespbbNP_001252536.1 HLH 80..133 CDD:278439 22/52 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.