DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH54F and tcf21

DIOPT Version :9

Sequence 1:NP_477302.1 Gene:HLH54F / 37027 FlyBaseID:FBgn0022740 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_001103518.1 Gene:tcf21 / 100126209 XenbaseID:XB-GENE-484805 Length:179 Species:Xenopus tropicalis


Alignment Length:110 Identity:53/110 - (48%)
Similarity:63/110 - (57%) Gaps:21/110 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PRKKRSSSPTEFFDDDFDEDASSQSSQPP----------VQRNAANARERMRMRVLSSAYGRLKT 56
            |:|.|.:|         .:...:.|.:.|          |||||||||||.||||||.|:.||||
 Frog    49 PKKGRGTS---------GKRRKAPSKKSPLGNINQEGKQVQRNAANARERARMRVLSKAFSRLKT 104

  Fly    57 KLPNIPPDTKLSKLDTLRLATLYIKQL--ITAVETGSHSQNHPHN 99
            .||.:|||||||||||||||:.||..|  |.|.:...:...||.|
 Frog   105 TLPWVPPDTKLSKLDTLRLASSYIAHLRQILANDKYENGYIHPVN 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH54FNP_477302.1 HLH 32..83 CDD:278439 40/50 (80%)
tcf21NP_001103518.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..87 13/46 (28%)
bHLH_TS_TCF21_capsulin 77..140 CDD:381547 44/62 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I8386
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004410
OrthoInspector 1 1.000 - - otm48166
Panther 1 1.100 - - O PTHR23349
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5029
SonicParanoid 1 1.000 - - X3129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.040

Return to query results.
Submit another query.