DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH54F and msc

DIOPT Version :9

Sequence 1:NP_477302.1 Gene:HLH54F / 37027 FlyBaseID:FBgn0022740 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_001096235.1 Gene:msc / 100124790 XenbaseID:XB-GENE-978233 Length:180 Species:Xenopus tropicalis


Alignment Length:179 Identity:60/179 - (33%)
Similarity:79/179 - (44%) Gaps:70/179 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RKKR----SSSPTEFFDDDFDEDASSQSSQ--PPVQRNAANARERMRMRVLSSAYGRLKTKLPNI 61
            ::||    |.||        |:...|:||:  ...||:|||||||.||||||.|:.||||.||.:
 Frog    55 KRKRISRGSQSP--------DKKQPSRSSKDCKQSQRHAANARERARMRVLSKAFSRLKTSLPWV 111

  Fly    62 PPDTKLSKLDTLRLATLYIKQLITAVETGSHSQNHPHNHNQHHSLNHSHSSTTSSEGLDTSHMAD 126
            |||||||||||||||:.||..|...::...:..::.|..|                         
 Frog   112 PPDTKLSKLDTLRLASSYIAHLRQLLQEDRYENSYVHPVN------------------------- 151

  Fly   127 SSGGGNYNFHNNGHGMSWPFEFHQSSRSLAFAP------SSSTTSSARM 169
                           ::|||          .||      |..||::.|:
 Frog   152 ---------------LTWPF----------VAPGRPDCDSKETTAALRL 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH54FNP_477302.1 HLH 32..83 CDD:278439 39/50 (78%)
mscNP_001096235.1 bHLH_SF 79..144 CDD:381792 40/64 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I8386
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004410
OrthoInspector 1 1.000 - - otm48166
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5029
SonicParanoid 1 1.000 - - X3129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.