DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH54F and si:ch211-246m6.4

DIOPT Version :9

Sequence 1:NP_477302.1 Gene:HLH54F / 37027 FlyBaseID:FBgn0022740 Length:242 Species:Drosophila melanogaster
Sequence 2:XP_001340709.1 Gene:si:ch211-246m6.4 / 100000527 ZFINID:ZDB-GENE-050208-498 Length:193 Species:Danio rerio


Alignment Length:137 Identity:42/137 - (30%)
Similarity:66/137 - (48%) Gaps:25/137 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PRKKRSSSPTEFFDDDFDEDASSQSS---QP-------------------PVQRNAANARERMRM 44
            |.....|.|::..|.|...|:|.:|:   .|                   ..||.|||||||.|.
Zfish    32 PAHDTQSLPSDPDDLDSGSDSSEKSTGAGSPTRGHREVRRRRGSRRLAGVSKQRQAANARERDRT 96

  Fly    45 RVLSSAYGRLKTKLPNIPPDTKLSKLDTLRLATLYIKQLITAVETGSHSQN-HPHNHNQHHSLNH 108
            ..:::|:..|:|.:|..|.|.||||::|||||:.||..|...:..|...:: .|  ..::|::..
Zfish    97 HSVNTAFTSLRTLIPTEPADRKLSKIETLRLASSYISHLANVLLLGEDCRDGQP--CLKYHNILQ 159

  Fly   109 SHSSTTS 115
            |:::..|
Zfish   160 SNANLKS 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH54FNP_477302.1 HLH 32..83 CDD:278439 27/50 (54%)
si:ch211-246m6.4XP_001340709.1 HLH 84..135 CDD:278439 27/50 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583768
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.