DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sardh and l(2)37Bb

DIOPT Version :9

Sequence 1:NP_611263.1 Gene:Sardh / 37026 FlyBaseID:FBgn0034276 Length:894 Species:Drosophila melanogaster
Sequence 2:NP_536791.1 Gene:l(2)37Bb / 49427 FlyBaseID:FBgn0002021 Length:515 Species:Drosophila melanogaster


Alignment Length:425 Identity:96/425 - (22%)
Similarity:168/425 - (39%) Gaps:78/425 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 DVVVIGGGSAGCHTLYHL---ARRGVKAVLLERAQLTA--GTTWHTAGLLWRLR-PNDVDIQLLA 96
            ||::||||..|....|.|   ||.|:..|::|:....|  .|.....||..:.. |.::.:.|.|
  Fly    99 DVLIIGGGGVGSSIAYWLKEKARDGLNVVVVEKDDTYAQSATRVSVGGLCQQFSLPENIQMSLFA 163

  Fly    97 NS--RRMLQQLEEETELDPGWIQNGGIFIAHNETRLDEYRRLATVGSALGIENQVLSPEDTQKLF 159
            ..  |...:...||..|.  :..:|.:.:| .|...:..:|.:.:.:.||..|::|:.:.....|
  Fly   164 ADFLRSARKHFGEEVPLQ--FTPHGHLMLA-GEEHAESLKRSSQLQNELGARNELLTADRLTARF 225

  Fly   160 PLLDPSAF-VGALYSPGDGVMDPAMLCAALKKAATNLGAQVIENCGVDDLLLEQT---------- 213
            |.|:.... :|.|....:|..:|..|.:..:::|:..||..|....||.....||          
  Fly   226 PWLNTKGIALGCLGLEKEGWFNPLALLSNFRRSASGYGAHFISGQVVDFEFKSQTDISVVTDLGS 290

  Fly   214 ----ARGKKVVGVSTPFGDIKAEK----VVNATGVWGRDL--VARHGT-----HLPLVPM----K 259
                ..|.:...:..|.|..:..|    |::| |.....:  :||.|.     .:|| |:    :
  Fly   291 NEGAYTGLEKAVIQLPDGTRRTCKFALCVISA-GASSEQIARLARIGVGPGILRVPL-PINARKR 353

  Fly   260 HAYIV---SESIPGVRGLPNIRDHDYSTYFRIQGDAICMGGYEPNPILLEPVPKDFHFGLYELDW 321
            :.|.:   ::|.||: .:|...|.. ..:.|..|    :||   |.|.::...::::..:  :|.
  Fly   354 YMYAINSQAQSAPGM-NMPMTIDPS-GIFIRRDG----LGG---NYICVQDSTEEYNSAM--IDP 407

  Fly   322 SVFETHVE----------GAQKLCPSYAKYGVKSTVCGPESFTPDHKPLMGPDPNLDGLYHNCGF 376
            ..|..|:.          |..::..|:|.       |...: ..|...::|..|..:.||...||
  Fly   408 QYFAQHIRPHLYNRIPVLGEAQVVDSWAG-------CYDHN-VYDENGILGAHPYYNNLYLATGF 464

  Fly   377 NSAGMMFGGGCGEQTALWVIQGQ---PDLPMFGFD 408
            :..|:......|...:..::.||   .||....||
  Fly   465 SGHGVQQSLAVGRAISELIMDGQFRTIDLSRLSFD 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SardhNP_611263.1 DadA 33..412 CDD:223737 96/425 (23%)
NADB_Rossmann 37..>76 CDD:304358 16/42 (38%)
nuc_hydro 203..>281 CDD:294156 23/109 (21%)
FAO_M 398..449 CDD:292961 6/14 (43%)
GcvT 446..884 CDD:223481
GCV_T 456..767 CDD:279857
GCV_T_C 774..867 CDD:285832
l(2)37BbNP_536791.1 DadA 113..501 CDD:223737 89/411 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456420
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13847
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.