DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sardh and L2HGDH

DIOPT Version :9

Sequence 1:NP_611263.1 Gene:Sardh / 37026 FlyBaseID:FBgn0034276 Length:894 Species:Drosophila melanogaster
Sequence 2:NP_001286076.1 Gene:L2HGDH / 35156 FlyBaseID:FBgn0032729 Length:455 Species:Drosophila melanogaster


Alignment Length:434 Identity:92/434 - (21%)
Similarity:160/434 - (36%) Gaps:106/434 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RILQQASRR-----GISKQVREDGGARR-EPSGFLPGAADVVVIGGGSAGCHTLYHLARR--GVK 61
            |:|.|..||     |::.........:| :.|....|..|:||:|||..|..:...:..|  .:|
  Fly     5 RLLVQGLRRSLLNVGVAAPNESTATHKRSQHSSSSCGDYDLVVVGGGIVGAASAREIVLRHPSLK 69

  Fly    62 AVLLER-AQLTAGTTWHTAGLLWR---LRPNDVDIQLLANSRRMLQQLEEETELDPGWIQNGGIF 122
            ..:||: .:|....:.|.:|::..   .:|..:..:|......:.....:|.::.  :.:.|.:.
  Fly    70 VAVLEKECKLAKHQSGHNSGVIHAGIYYKPGTLKARLCVEGMHLAYAYLDEKKIP--YKKTGKLI 132

  Fly   123 IAHNETRLDEYRRLATVGSALGIEN-QVLSPEDTQKLFPLLDPSAFVGALYSPGDGVMDPAMLCA 186
            :|.:|..:...:.|...|.|..:.: :::...:.|::.|....   |.||:||..|::|..::  
  Fly   133 VATDEKEVKLLKDLEKRGIANNVPDLRMIEGSEIQEIEPYCQG---VMALHSPHTGIVDWGLV-- 192

  Fly   187 ALKKAATNLGAQVIENCGVDDLLLE-------------------------QTARGKKVVGVSTPF 226
                  |....|..:.|| .|:.|:                         ||.|.|.|:......
  Fly   193 ------TEHYGQDFKQCG-GDIYLDFNVSKFTETKEGTDYPVTIHGAKPGQTVRTKNVLTCGGLQ 250

  Fly   227 GDIKAEKVVNATGVWGRD--LVARHGTHLPLVPMKHAYIVSESIPGVRGLPNIRDHDYSTYF--R 287
            .|:.|||    ||. .||  :|...|.:|.|...|...:.....|    :|:.|......:|  |
  Fly   251 SDLLAEK----TGC-PRDPRIVPFRGEYLLLTKEKQHMVKGNIYP----VPDPRFPFLGVHFTPR 306

  Fly   288 IQGDAICMGGYEPNPIL--------------------------LEPVPKDFHFGLYELDWSVF-E 325
            :.| :|.:|   ||.:|                          ::...|...|||.|:..|.| .
  Fly   307 MDG-SIWLG---PNAVLALKREGYTWGDINLFELFDALRYPGFVKMASKYIGFGLSEMSKSWFIN 367

  Fly   326 THVEGAQKLCPSYAKYGVKSTVCGPESFTPDHKPLMGPDPNLDG 369
            ..::..||..|...:|.::....|..:...|          |||
  Fly   368 LQIKALQKYIPDITEYDIQRGPAGVRAQAMD----------LDG 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SardhNP_611263.1 DadA 33..412 CDD:223737 84/400 (21%)
NADB_Rossmann 37..>76 CDD:304358 12/41 (29%)
nuc_hydro 203..>281 CDD:294156 25/104 (24%)
FAO_M 398..449 CDD:292961
GcvT 446..884 CDD:223481
GCV_T 456..767 CDD:279857
GCV_T_C 774..867 CDD:285832
L2HGDHNP_001286076.1 PRK11728 56..447 CDD:183292 76/383 (20%)
NADB_Rossmann 69..440 CDD:304358 75/370 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456419
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.