Sequence 1: | NP_611262.1 | Gene: | CG5002 / 37025 | FlyBaseID: | FBgn0034275 | Length: | 595 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_031754875.1 | Gene: | slc26a4.2 / 100485000 | XenbaseID: | XB-GENE-22062181 | Length: | 389 | Species: | Xenopus tropicalis |
Alignment Length: | 197 | Identity: | 50/197 - (25%) |
---|---|---|---|
Similarity: | 90/197 - (45%) | Gaps: | 30/197 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 353 SFTRTAVNNASGVKTPLGGAVTGALVLMALAFLTQTFYFIPKCTLAAIIIAAMISLVELHKIKD- 416
Fly 417 --MWKSKKKDLFPFVVTVLTCMFWSLEYGILCGIGANMVYILYSSARPH---------VDI-KLE 469
Fly 470 KINGH-----EVSVVDVKQKLDYASAEYLKEKV--------VRFLNNQNGETQLV--VIKGEEIN 519
Fly 520 SI 521 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5002 | NP_611262.1 | SUL1 | 36..564 | CDD:223732 | 50/197 (25%) |
HCO3_cotransp | 103..>385 | CDD:304903 | 10/31 (32%) | ||
STAS | 469..>544 | CDD:294402 | 17/68 (25%) | ||
slc26a4.2 | XP_031754875.1 | sulP | <3..336 | CDD:273284 | 50/197 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D252952at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |