DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5002 and slc26a4.2

DIOPT Version :9

Sequence 1:NP_611262.1 Gene:CG5002 / 37025 FlyBaseID:FBgn0034275 Length:595 Species:Drosophila melanogaster
Sequence 2:XP_031754875.1 Gene:slc26a4.2 / 100485000 XenbaseID:XB-GENE-22062181 Length:389 Species:Xenopus tropicalis


Alignment Length:197 Identity:50/197 - (25%)
Similarity:90/197 - (45%) Gaps:30/197 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   353 SFTRTAVNNASGVKTPLGGAVTGALVLMALAFLTQTFYFIPKCTLAAIIIAAMISLVELHKIKD- 416
            :.:|||:..:.|.||.:..||:..::|:|:..|.:....:.|..|:||:|..:..:..|  ||| 
 Frog    14 ALSRTAIQESIGGKTQIASAVSAGILLIAILALGKLLEPLQKSVLSAIVIVNLKGMFWL--IKDV 76

  Fly   417 --MWKSKKKDLFPFVVTVLTCMFWSLEYGILCGIGANMVYILYSSARPH---------VDI-KLE 469
              :||..:.|...:||:.:..:...|:.|:|.|:...::.::.....|.         .|| |..
 Frog    77 PRLWKESRWDSVSWVVSCIAAIILGLDIGLLVGLLFGLLTVMIRVQFPSCSSLGNVQGTDIYKNV 141

  Fly   470 KINGH-----EVSVVDVKQKLDYASAEYLKEKV--------VRFLNNQNGETQLV--VIKGEEIN 519
            ||..|     .:.:|.....:.|.:.|.||..:        ||..|.:|...:.:  :||..||:
 Frog   142 KIYKHISEPAGMKIVRFSSAIFYGNVEGLKNGIKSIVGFDAVRVFNKRNKALRKIKKLIKKGEIS 206

  Fly   520 SI 521
            |:
 Frog   207 SL 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5002NP_611262.1 SUL1 36..564 CDD:223732 50/197 (25%)
HCO3_cotransp 103..>385 CDD:304903 10/31 (32%)
STAS 469..>544 CDD:294402 17/68 (25%)
slc26a4.2XP_031754875.1 sulP <3..336 CDD:273284 50/197 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D252952at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.