DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10931 and RPN14

DIOPT Version :9

Sequence 1:NP_611261.1 Gene:CG10931 / 37024 FlyBaseID:FBgn0034274 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_011511.3 Gene:RPN14 / 852880 SGDID:S000002972 Length:417 Species:Saccharomyces cerevisiae


Alignment Length:328 Identity:69/328 - (21%)
Similarity:129/328 - (39%) Gaps:96/328 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 AFDSFKMPM--------------LPSQFHLENSMSPGYAIKHSLLGHSGCVTGLKFSSNGENLVS 73
            |.|:.|:.|              |.|.|:|:..:..         .|...:|.|||..:||.|:|
Yeast    98 AVDTAKLQMRRFILGTTEGDIKVLDSNFNLQREIDQ---------AHVSEITKLKFFPSGEALIS 153

  Fly    74 SSGDRLLKLWDLSATRCIQSLAGHGDGVNDVAWSAAGLIASCSDDMTVRLWDARSKLCVKVLEGH 138
            ||.|..||:|.:......::|.||...|.|:|....|                            
Yeast   154 SSQDMQLKIWSVKDGSNPRTLIGHRATVTDIAIIDRG---------------------------- 190

  Fly   139 SRYSFSCCFNPQANLLASTSFDETVRLWDVRTGKTLKIVHAHQDPITSVDFHRDGNIFVTSSYDG 203
                        .|:| |.|.|.|:|||:..||.|:...:..::|                 :||
Yeast   191 ------------RNVL-SASLDGTIRLWECGTGTTIHTFNRKENP-----------------HDG 225

  Fly   204 L--VRLWDSSTGHVLKTLVDVDNIPVGYVKFSPNGRYILSSTLNNTLRLWN-YKKPKCMRTYRGH 265
            :  :.|:..:.    :.|.::.......::|...|:|:::..::..:.:.| :.|.:.::.    
Yeast   226 VNSIALFVGTD----RQLHEISTSKKNNLEFGTYGKYVIAGHVSGVITVHNVFSKEQTIQL---- 282

  Fly   266 LNEFYCSNSNFSTTG--GIWIVSGSEDNTLCIWNLQTRE--LVQKISTEGDQILSTHCHPTANVI 326
            .::|.||.::.:..|  ..:|.:|.|:..|..|:|::.|  :.:.:..||..|.:.:....|..:
Yeast   283 PSKFTCSCNSLTVDGNNANYIYAGYENGMLAQWDLRSPECPVGEFLINEGTPINNVYFAAGALFV 347

  Fly   327 ASG 329
            :||
Yeast   348 SSG 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10931NP_611261.1 WD40 <48..341 CDD:225201 61/289 (21%)
WD40 49..341 CDD:238121 61/288 (21%)
WD40 repeat 59..96 CDD:293791 15/36 (42%)
WD40 repeat 102..137 CDD:293791 3/34 (9%)
WD40 repeat 142..178 CDD:293791 12/35 (34%)
WD40 repeat 185..220 CDD:293791 3/36 (8%)
WD40 repeat 227..263 CDD:293791 5/36 (14%)
WD40 repeat 271..309 CDD:293791 10/41 (24%)
WD40 repeat 314..340 CDD:293791 4/16 (25%)
RPN14NP_011511.3 WD40 repeat 96..133 CDD:293791 8/34 (24%)
WD40 133..>357 CDD:421866 61/293 (21%)
WD40 repeat 140..176 CDD:293791 15/35 (43%)
WD40 repeat 181..217 CDD:293791 16/76 (21%)
WD40 repeat 227..283 CDD:293791 7/63 (11%)
WD40 repeat 290..328 CDD:293791 8/37 (22%)
WD40 repeat 335..378 CDD:293791 4/16 (25%)
WD40 repeat 385..412 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0266
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.