DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10931 and AT1G64610

DIOPT Version :9

Sequence 1:NP_611261.1 Gene:CG10931 / 37024 FlyBaseID:FBgn0034274 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_176642.1 Gene:AT1G64610 / 842769 AraportID:AT1G64610 Length:647 Species:Arabidopsis thaliana


Alignment Length:391 Identity:76/391 - (19%)
Similarity:132/391 - (33%) Gaps:137/391 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 QFHLENSMSPGYAIKHSLLGHSGCVTGLKFSSNGENLVSSSGDRLLKLWDL-------------- 85
            ||...:||    .|......|.|.:..:|||.:|:.:.|:..|.::::|.:              
plant   201 QFKELSSM----CIDQEFSAHDGSILAMKFSPDGKYIASAGEDCVVRVWSITEEERTDTYEVAEV 261

  Fly    86 ----------------------------------SATRCI--------------QSLAGHGDGVN 102
                                              |.:.|:              ....||...:.
plant   262 DSGVYFGMNQRSQIEPLKINNEKTEKKSSFLRKSSDSTCVVLPPTIFSISEKPLHEFKGHIGEIL 326

  Fly   103 DVAWSAAGLIASCSDDMTVRLWDARSKLCVKVLEGHSRYSFSCCFNP-QANLLASTSFDETVRLW 166
            |::||..|.:.|.|.|.|||||......|::... |:.:.....||| ..|...|.|.|..||:|
plant   327 DLSWSEKGYLLSSSVDETVRLWRVGCDECLRTFT-HNNFVTCVAFNPVDDNYFISGSIDGKVRIW 390

  Fly   167 DVRTGKTLKIVHAHQDPITSVDFHRDGNIFVTSSYDGLVRLW----------------------- 208
            ||...:.:..... :|.:|:|.:..|....|..|..|..|.:                       
plant   391 DVTRCRVVDYTDI-RDIVTAVCYRPDAKGAVIGSMTGNCRFYHIFENQLQMDQEINVHGKKKVAS 454

  Fly   209 -----------DSSTGHVLKTLVD----------------VDNIPVGYVKFSPNGRYILSSTLNN 246
                       ||.:..|:.|..|                ..::......|..:|::|:|::.::
plant   455 KRISGLQYLPSDSDSDKVMVTSADSQIRIICGEDVICKLKASSLRTTSASFISDGKHIISTSEDS 519

  Fly   247 TLRLWNYKK----------PKCMRTYRGHLNEFYCSNSNFSTTGGIWIVSGSEDN-TLCIWNLQT 300
            .:.:|:|.:          ||.:|:|.|.|:.    |::.:..   |:..|..|. :.||.:|..
plant   520 YINVWSYSQLPSKKPYSETPKSIRSYEGFLSH----NASVAIP---WLRQGRRDGLSECITDLDM 577

  Fly   301 R 301
            :
plant   578 K 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10931NP_611261.1 WD40 <48..341 CDD:225201 72/378 (19%)
WD40 49..341 CDD:238121 71/377 (19%)
WD40 repeat 59..96 CDD:293791 9/98 (9%)
WD40 repeat 102..137 CDD:293791 13/34 (38%)
WD40 repeat 142..178 CDD:293791 12/36 (33%)
WD40 repeat 185..220 CDD:293791 11/68 (16%)
WD40 repeat 227..263 CDD:293791 9/45 (20%)
WD40 repeat 271..309 CDD:293791 7/32 (22%)
WD40 repeat 314..340 CDD:293791
AT1G64610NP_176642.1 WD40 <206..550 CDD:225201 66/349 (19%)
WD40 212..525 CDD:295369 56/314 (18%)
WD40 repeat 222..260 CDD:293791 7/37 (19%)
WD40 repeat 265..305 CDD:293791 2/39 (5%)
WD40 repeat 326..360 CDD:293791 13/33 (39%)
WD40 repeat 365..399 CDD:293791 12/33 (36%)
WD40 repeat 408..445 CDD:293791 7/36 (19%)
WD40 repeat 457..494 CDD:293791 5/36 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.