DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10931 and PUB54

DIOPT Version :9

Sequence 1:	NP_611261.1	Gene:	CG10931 / 37024	FlyBaseID:	FBgn0034274	Length:	345	Species:	Drosophila melanogaster
Sequence 2:	NP_171674.2	Gene:	PUB54 / 839251	AraportID:	AT1G01680	Length:	308	Species:	Arabidopsis thaliana

Alignment Length:	113	Identity:	27/113 - (23%)
Similarity:	41/113 - (36%)	Gaps:	37/113 - (32%)

- Green bases have known domain annotations that are detailed below.

  Fly   156 STSFDETVRLWDVRTGKTLKIVHAHQDPITSVDFHRDGNIFVTSSYDGLVRLWDSSTGHVL-KTL 219
            |...||..||.|.:...:::|:   :||..:.    ||..:....:    |.|..|.|... ||.
plant   225 SNESDEDPRLEDFKCPISMEIM---RDPHVAA----DGFTYEAEEF----RKWLRSGGRTSPKTN 278

  Fly   220 VDVDN---IPVGYVKFSPNGRYILSSTLNNTLRL----WNYKKPKCMR 260
            ..::|   :|                  |:|||:    |..|.|...|
plant   279 KPLENHNLVP------------------NHTLRIIIKDWLEKNPNYKR 308

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10931	NP_611261.1	WD40	<48..341	CDD:225201	27/113 (24%)
		WD40	49..341	CDD:238121	27/113 (24%)
		WD40 repeat	59..96	CDD:293791
		WD40 repeat	102..137	CDD:293791
		WD40 repeat	142..178	CDD:293791	7/21 (33%)
		WD40 repeat	185..220	CDD:293791	8/35 (23%)
		WD40 repeat	227..263	CDD:293791	8/38 (21%)
		WD40 repeat	271..309	CDD:293791
		WD40 repeat	314..340	CDD:293791
PUB54	NP_171674.2	STK_N	5..153	CDD:238947
		RING-Ubox_WDSUB1_like	237..278	CDD:319569	10/51 (20%)
		U-box domain, a modified RING finger	239..277	CDD:319569	9/48 (19%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D957291at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.010