DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10931 and AT2G45920

DIOPT Version :9

Sequence 1:	NP_611261.1	Gene:	CG10931 / 37024	FlyBaseID:	FBgn0034274	Length:	345	Species:	Drosophila melanogaster
Sequence 2:	NP_182116.2	Gene:	AT2G45920 / 819200	AraportID:	AT2G45920	Length:	400	Species:	Arabidopsis thaliana

Alignment Length:	80	Identity:	20/80 - (25%)
Similarity:	31/80 - (38%)	Gaps:	8/80 - (10%)

- Green bases have known domain annotations that are detailed below.

  Fly    14 ETEIAIPEAAFDSFKMPMLPSQFHLENSMSPGYAIKHSLLGHSGCVTGLKFSSNGENLVSSSGDR 78
            |.|.:..||:.::||        |.|.......|||......|..:..||.....|..:....::
plant   199 EAEKSKKEASLEAFK--------HQEVVKEKNEAIKRGKEWESAYLEELKQRKETEMELKKVREK 255

  Fly    79 LLKLWDLSATRCIQS 93
            |.|:..:|..|..:|
plant   256 LEKMRYISENRITES 270

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10931	NP_611261.1	WD40	<48..341	CDD:225201	11/46 (24%)
		WD40	49..341	CDD:238121	10/45 (22%)
		WD40 repeat	59..96	CDD:293791	8/35 (23%)
		WD40 repeat	102..137	CDD:293791
		WD40 repeat	142..178	CDD:293791
		WD40 repeat	185..220	CDD:293791
		WD40 repeat	227..263	CDD:293791
		WD40 repeat	271..309	CDD:293791
		WD40 repeat	314..340	CDD:293791
AT2G45920	NP_182116.2	STK_N	15..144	CDD:238947
		Ribosomal_S25	213..306	CDD:413175	15/66 (23%)
		Ubox	328..391	CDD:128780
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D957291at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.010