| Sequence 1: | NP_611261.1 | Gene: | CG10931 / 37024 | FlyBaseID: | FBgn0034274 | Length: | 345 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001350485.1 | Gene: | PAAF1 / 80227 | HGNCID: | 25687 | Length: | 393 | Species: | Homo sapiens |
| Alignment Length: | 243 | Identity: | 60/243 - (24%) |
|---|---|---|---|
| Similarity: | 99/243 - (40%) | Gaps: | 51/243 - (20%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 105 AWSAAGLIASCSDDMTVRLW-DARSKLCVKVLEGHSRYS--FSCCFNPQANLLASTSFDETVRLW 166
Fly 167 DVRTGKTLKIVHAHQDPITSVDFHRDGNIFVTSSYDGLVRLWDSSTGHVLKTLVDVDNIPVGYVK 231
Fly 232 FSPNGRYILSSTLNNTLRLWNYKKPKCMRTYRGHLNEFYCSNSNFSTTGGIW----------IVS 286
Fly 287 GSEDNTLCIWNLQTRELVQKISTEGDQILSTHCHPTANVIASGALQNS 334 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG10931 | NP_611261.1 | WD40 | <48..341 | CDD:225201 | 60/243 (25%) |
| WD40 | 49..341 | CDD:238121 | 60/243 (25%) | ||
| WD40 repeat | 59..96 | CDD:293791 | |||
| WD40 repeat | 102..137 | CDD:293791 | 8/32 (25%) | ||
| WD40 repeat | 142..178 | CDD:293791 | 9/37 (24%) | ||
| WD40 repeat | 185..220 | CDD:293791 | 12/34 (35%) | ||
| WD40 repeat | 227..263 | CDD:293791 | 10/35 (29%) | ||
| WD40 repeat | 271..309 | CDD:293791 | 9/47 (19%) | ||
| WD40 repeat | 314..340 | CDD:293791 | 7/21 (33%) | ||
| PAAF1 | NP_001350485.1 | WD40 | 90..339 | CDD:330360 | 42/169 (25%) |
| WD40 repeat | 96..133 | CDD:293791 | 13/37 (35%) | ||
| WD40 repeat | 139..175 | CDD:293791 | 9/35 (26%) | ||
| WD40 repeat | 180..223 | CDD:293791 | 8/51 (16%) | ||
| WD40 repeat | 232..279 | CDD:293791 | 2/2 (100%) | ||
| WD40 repeat | 284..318 | CDD:293791 | |||
| WD40 repeat | 326..359 | CDD:293791 | |||
| WD40 repeat | 366..388 | CDD:293791 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG0266 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||