DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10931 and WDR25

DIOPT Version :9

Sequence 1:NP_611261.1 Gene:CG10931 / 37024 FlyBaseID:FBgn0034274 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001154948.1 Gene:WDR25 / 79446 HGNCID:21064 Length:544 Species:Homo sapiens


Alignment Length:355 Identity:88/355 - (24%)
Similarity:147/355 - (41%) Gaps:50/355 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PGDSETEIAIPEAAFDSFKMPMLPSQFHLENSMSPGYAIKHSLLGHSGCVTGLKFS---SNGENL 71
            ||.||            |..|.|.|  |.:.:..|...:.| |.||.|.|..:::.   |....|
Human   215 PGVSE------------FIQPYLNS--HYKETTVPRKVLFH-LRGHRGPVNTIQWCPVLSKSHML 264

  Fly    72 VSSSGDRLLKLWD-LSATRCIQSLAGHGDGVNDVAWSAAG-LIASCSDDMTVRLWDARSKLCVKV 134
            :|:|.|:..|:|: :.:..|:|:.:.|.:.|....|:..| .|.|...|..:.|.|..:.  .::
Human   265 LSTSMDKTFKVWNAVDSGHCLQTYSLHTEAVRAARWAPCGRRILSGGFDFALHLTDLETG--TQL 327

  Fly   135 LEGHSRYSFSCC-FNPQ-ANLLASTSFDETVRLWDVRTGKTLKIVHAHQDPITSVDFHRDGNIFV 197
            ..|.|.:..:.. |:|: .|:.....|...::.||:||||.::...|.......:.|.|:|:.|:
Human   328 FSGRSDFRITTLKFHPKDHNIFLCGGFSSEMKAWDIRTGKVMRSYKATIQQTLDILFLREGSEFL 392

  Fly   198 TS-------SYDGLVRLWDSSTGHVLKTLVDVDNIPVGYVKFSPNGRYILSSTLNNTLRL----W 251
            :|       |.|..:..||..|...:...:..:......:...|.....|:.|..|.|.|    |
Human   393 SSTDASTRDSADRTIIAWDFRTSAKISNQIFHERFTCPSLALHPREPVFLAQTNGNYLALFSTVW 457

  Fly   252 NYKKPKCMRTYRGHLNEFY-----CSNSNFSTTGGIWIVSGSEDNTLCIWNLQTRELVQKISTEG 311
            .|:..: .|.|.||..|.|     ||      .||..:|:||.|..:.:::.:|......:....
Human   458 PYRMSR-RRRYEGHKVEGYSVGCECS------PGGDLLVTGSADGRVLMYSFRTASRACTLQGHT 515

  Fly   312 DQILSTHCHPT-ANVIASGALQNSYAIKIW 340
            ...:.|..||. .:|:|:.:....  :|||
Human   516 QACVGTTYHPVLPSVLATCSWGGD--MKIW 543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10931NP_611261.1 WD40 <48..341 CDD:225201 78/317 (25%)
WD40 49..341 CDD:238121 78/316 (25%)
WD40 repeat 59..96 CDD:293791 10/40 (25%)
WD40 repeat 102..137 CDD:293791 7/35 (20%)
WD40 repeat 142..178 CDD:293791 10/37 (27%)
WD40 repeat 185..220 CDD:293791 10/41 (24%)
WD40 repeat 227..263 CDD:293791 9/39 (23%)
WD40 repeat 271..309 CDD:293791 9/37 (24%)
WD40 repeat 314..340 CDD:293791 6/26 (23%)
WDR25NP_001154948.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 17..74
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 183..208
WD40 239..543 CDD:330360 76/315 (24%)
WD 1 244..286 12/41 (29%)
WD40 repeat 251..290 CDD:293791 9/38 (24%)
WD 2 290..329 9/40 (23%)
WD40 repeat 296..330 CDD:293791 7/35 (20%)
WD 3 330..373 12/42 (29%)
WD40 repeat 336..373 CDD:293791 10/36 (28%)
WD 4 375..420 10/44 (23%)
WD40 repeat 380..422 CDD:293791 10/41 (24%)
WD 5 424..463 8/38 (21%)
WD40 repeat 429..468 CDD:293791 9/39 (23%)
WD 6 469..510 13/46 (28%)
WD40 repeat 476..512 CDD:293791 9/41 (22%)
WD 7 513..544 8/33 (24%)
WD40 repeat 518..543 CDD:293791 6/26 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.