| Sequence 1: | NP_611261.1 | Gene: | CG10931 / 37024 | FlyBaseID: | FBgn0034274 | Length: | 345 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001071237.1 | Gene: | wdsub1 / 777721 | ZFINID: | ZDB-GENE-061110-97 | Length: | 487 | Species: | Danio rerio |
| Alignment Length: | 328 | Identity: | 81/328 - (24%) |
|---|---|---|---|
| Similarity: | 130/328 - (39%) | Gaps: | 94/328 - (28%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 91 IQSLAGHGDGVNDVAWSAAGLIASCSDDMTVRLWDAR--SKLCVKVLEGHSRYSFSCCFNPQANL 153
Fly 154 LASTSFDETVRLWDVRTGKTLKIV-HAHQDPITSVDFHRDGNIFVTSSYDGLVRLWDSSTGHVLK 217
Fly 218 TLVDVDNIPVGYVKFSPNGRYILSSTLNNTLRLWNYK--------------------KPKCMRTY 262
Fly 263 RGHLNEFYCSNSNFSTTG-----GIWI------------------------------------VS 286
Fly 287 GSEDNTLCIWNLQTRELVQKISTEGDQILSTHCH----------PTANVIASGALQNSYAIKIWK 341
Fly 342 SSE 344 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG10931 | NP_611261.1 | WD40 | <48..341 | CDD:225201 | 79/323 (24%) |
| WD40 | 49..341 | CDD:238121 | 79/323 (24%) | ||
| WD40 repeat | 59..96 | CDD:293791 | 2/4 (50%) | ||
| WD40 repeat | 102..137 | CDD:293791 | 13/36 (36%) | ||
| WD40 repeat | 142..178 | CDD:293791 | 12/36 (33%) | ||
| WD40 repeat | 185..220 | CDD:293791 | 9/34 (26%) | ||
| WD40 repeat | 227..263 | CDD:293791 | 10/55 (18%) | ||
| WD40 repeat | 271..309 | CDD:293791 | 11/78 (14%) | ||
| WD40 repeat | 314..340 | CDD:293791 | 9/35 (26%) | ||
| wdsub1 | NP_001071237.1 | WD40 | 4..309 | CDD:238121 | 79/323 (24%) |
| WD 1 | 10..47 | 15/37 (41%) | |||
| WD40 repeat | 17..52 | CDD:293791 | 12/35 (34%) | ||
| WD40 | 50..>371 | CDD:225201 | 64/282 (23%) | ||
| WD 2 | 52..93 | 14/40 (35%) | |||
| WD40 repeat | 58..96 | CDD:293791 | 13/37 (35%) | ||
| WD 3 | 95..134 | 9/38 (24%) | |||
| WD40 repeat | 100..134 | CDD:293791 | 8/33 (24%) | ||
| WD 4 | 137..176 | 8/38 (21%) | |||
| WD40 repeat | 143..178 | CDD:293791 | 7/34 (21%) | ||
| WD 5 | 179..227 | 9/53 (17%) | |||
| WD40 repeat | 184..236 | CDD:293791 | 9/57 (16%) | ||
| WD 6 | 237..276 | 8/48 (17%) | |||
| WD40 repeat | 242..278 | CDD:293791 | 8/45 (18%) | ||
| WD 7 | 279..318 | 11/36 (31%) | |||
| WD40 repeat | 284..308 | CDD:293791 | 7/25 (28%) | ||
| SAM_WDSUB1 | 343..414 | CDD:188904 | |||
| SAM | 344..409 | CDD:197735 | |||
| RING | 418..483 | CDD:302633 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D957291at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.920 | |||||