| Sequence 1: | NP_611261.1 | Gene: | CG10931 / 37024 | FlyBaseID: | FBgn0034274 | Length: | 345 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_083963.1 | Gene: | Wdr38 / 76646 | MGIID: | 1923896 | Length: | 303 | Species: | Mus musculus |
| Alignment Length: | 279 | Identity: | 82/279 - (29%) |
|---|---|---|---|
| Similarity: | 133/279 - (47%) | Gaps: | 49/279 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 55 HSGCVTGLKFSSNGENLVSSSGDRLLKLWDLSATRCIQSLAGHGDGVNDVAWSAAG-LIASCSDD 118
Fly 119 MTVRLWD-ARSKLCVKVLEGHSRYSFSCCFNPQANLLASTSFDETVRLWDVRTGKTLKIVHAHQD 182
Fly 183 PITSVDFHRDGNIFVTSSYDGLVRLWD--------------SSTGHVL----------------K 217
Fly 218 TLV----DVDNIP---------VGYVKFSPNGRYILSSTLNNTLRLWNYKKPKCMRTYRGHLNEF 269
Fly 270 YCSNSNFSTTGGIWIVSGS 288 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG10931 | NP_611261.1 | WD40 | <48..341 | CDD:225201 | 82/279 (29%) |
| WD40 | 49..341 | CDD:238121 | 82/279 (29%) | ||
| WD40 repeat | 59..96 | CDD:293791 | 10/36 (28%) | ||
| WD40 repeat | 102..137 | CDD:293791 | 19/36 (53%) | ||
| WD40 repeat | 142..178 | CDD:293791 | 9/35 (26%) | ||
| WD40 repeat | 185..220 | CDD:293791 | 13/64 (20%) | ||
| WD40 repeat | 227..263 | CDD:293791 | 10/35 (29%) | ||
| WD40 repeat | 271..309 | CDD:293791 | 5/18 (28%) | ||
| WD40 repeat | 314..340 | CDD:293791 | |||
| Wdr38 | NP_083963.1 | WD40 | <18..300 | CDD:225201 | 82/279 (29%) |
| WD 1 | 24..63 | 11/37 (30%) | |||
| WD40 | 25..300 | CDD:238121 | 82/279 (29%) | ||
| WD40 repeat | 31..66 | CDD:293791 | 9/34 (26%) | ||
| WD 2 | 66..105 | 20/39 (51%) | |||
| WD40 repeat | 72..108 | CDD:293791 | 19/36 (53%) | ||
| WD 3 | 108..147 | 12/38 (32%) | |||
| WD40 repeat | 113..149 | CDD:293791 | 9/35 (26%) | ||
| WD 4 | 150..189 | 12/38 (32%) | |||
| WD40 repeat | 156..194 | CDD:293791 | 9/37 (24%) | ||
| WD 5 | 195..233 | 6/37 (16%) | |||
| WD40 repeat | 200..235 | CDD:293791 | 4/34 (12%) | ||
| WD 6 | 236..277 | 10/40 (25%) | |||
| WD 7 | 279..303 | 6/24 (25%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG0266 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.810 | |||||