DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10931 and Ambra1

DIOPT Version :9

Sequence 1:NP_611261.1 Gene:CG10931 / 37024 FlyBaseID:FBgn0034274 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001127813.3 Gene:Ambra1 / 59319 RGDID:621330 Length:1300 Species:Rattus norvegicus


Alignment Length:139 Identity:37/139 - (26%)
Similarity:71/139 - (51%) Gaps:8/139 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 LIASCSDDMTVRLWDARSKLCVKVLEGHSRYSFSCCFNPQ-ANLLASTSFDETVRLWDVRTGKTL 174
            |:||...:..:.:.:.::..||..|.||.|..:...|:|. :.|:||...|..||:||:..|...
  Rat    67 LLASTHVNHNIYITEVKTGKCVHSLIGHRRTPWCVTFHPTISGLIASGCLDGEVRIWDLHGGSES 131

  Fly   175 KIVHAHQDPITSVDFHRDGNIFVTSSYDGLVRLWDSSTGH---VLKTLVDVDNIPVGYVKFSPNG 236
            ....:: :.|.|:.||....:.:.::.:. :..||.|...   |:||..:::.:.:  |:|.|.|
  Rat   132 WFTDSN-NAIASLAFHPTAQLLLIATANE-IHFWDWSRREPFAVVKTASEMERVRL--VRFDPLG 192

  Fly   237 RYILSSTLN 245
            .|:|::.:|
  Rat   193 HYLLTAIVN 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10931NP_611261.1 WD40 <48..341 CDD:225201 37/139 (27%)
WD40 49..341 CDD:238121 37/139 (27%)
WD40 repeat 59..96 CDD:293791
WD40 repeat 102..137 CDD:293791 6/25 (24%)
WD40 repeat 142..178 CDD:293791 11/36 (31%)
WD40 repeat 185..220 CDD:293791 9/37 (24%)
WD40 repeat 227..263 CDD:293791 7/19 (37%)
WD40 repeat 271..309 CDD:293791
WD40 repeat 314..340 CDD:293791
Ambra1NP_001127813.3 WD40 repeat 56..92 CDD:293791 5/24 (21%)
WD40 <59..198 CDD:421866 36/134 (27%)
WD40 repeat 99..135 CDD:293791 11/35 (31%)
WD40 repeat 140..176 CDD:293791 8/36 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0266
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.