DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10931 and dcaf11

DIOPT Version :9

Sequence 1:NP_611261.1 Gene:CG10931 / 37024 FlyBaseID:FBgn0034274 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001026845.1 Gene:dcaf11 / 567578 ZFINID:ZDB-GENE-050809-116 Length:541 Species:Danio rerio


Alignment Length:365 Identity:78/365 - (21%)
Similarity:134/365 - (36%) Gaps:112/365 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ELIETASTPGDSETEIAIPEAAFDSFKMPMLPSQFHLENSMSPGYAIKHSLLGHSGCVTGLKFSS 66
            :.|...|..||:||..|          :.:.|.:...                   ||..|..|:
Zfish   244 DYIHVCSVDGDNETHTA----------LDLNPDERRF-------------------CVFSLAAST 279

  Fly    67 NGENLVSSSGDRLLKLWDLSATRCIQSLAGHGDGVNDVAW--SAAGLIASCSDDMTVRLWDARSK 129
            :|:.::..:.|..|.::|....:....:..|.|.||.||:  |::.|:.|.|||...::||.|: 
Zfish   280 DGKEILGGANDGCLYVFDREQNKRTLKIDAHEDDVNAVAFADSSSQLLFSGSDDALCKVWDRRT- 343

  Fly   130 LCVKVLEGHSRYSFSCCFNPQANLLASTSFDETVRLWDVRTGKTLKIVH--AHQDPITSVDFHRD 192
                                                  :|..:...:.|  .|:|.||.:....|
Zfish   344 --------------------------------------LREDRPQPVGHLAGHRDGITFIHSKGD 370

  Fly   193 GNIFVTSSYDGLVRLWDSSTGHVLKTLVDVDNIPVGYVKFSPNGRYILSSTLNNTLRLWNY---- 253
            ....:::|.|..::|||..                   ||||. ..:.:|.|..|.:.|:|    
Zfish   371 ARYLISNSKDQTIKLWDVR-------------------KFSPK-EGLAASRLAVTQQNWDYRWQQ 415

  Fly   254 ------KKPK-----CMRTYRGH--LNEFY-CSNSNFSTTGGIWIVSGSEDNTLCIWNLQTRELV 304
                  |:.|     .:.|||||  |:... |..|...:||..:|.:|.....:.|:::.|..:|
Zfish   416 VPQRALKRHKLTGDTSVMTYRGHGVLHTLIRCRFSPEFSTGQKFIYTGCSTGKIVIYDVLTGSVV 480

  Fly   305 QKISTEGDQILSTHCHPTANVIASGALQNSYAIKIWKSSE 344
            .|:|.....:.....||..|.:.|.:...  ||::|:.::
Zfish   481 CKLSNHDACVRDVSWHPYNNNMVSSSWDG--AIRLWEHTQ 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10931NP_611261.1 WD40 <48..341 CDD:225201 69/314 (22%)
WD40 49..341 CDD:238121 69/313 (22%)
WD40 repeat 59..96 CDD:293791 7/36 (19%)
WD40 repeat 102..137 CDD:293791 12/36 (33%)
WD40 repeat 142..178 CDD:293791 1/35 (3%)
WD40 repeat 185..220 CDD:293791 7/34 (21%)
WD40 repeat 227..263 CDD:293791 12/50 (24%)
WD40 repeat 271..309 CDD:293791 10/37 (27%)
WD40 repeat 314..340 CDD:293791 6/25 (24%)
dcaf11NP_001026845.1 WD40 175..515 CDD:225201 77/360 (21%)
WD40 178..515 CDD:295369 77/360 (21%)
WD40 repeat 225..265 CDD:293791 7/30 (23%)
WD40 repeat 273..309 CDD:293791 6/35 (17%)
WD40 repeat 314..356 CDD:293791 15/80 (19%)
WD40 repeat 390..436 CDD:293791 12/46 (26%)
WD40 repeat 448..474 CDD:293791 6/25 (24%)
WD40 repeat 490..514 CDD:293791 6/25 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0266
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.