Sequence 1: | NP_611261.1 | Gene: | CG10931 / 37024 | FlyBaseID: | FBgn0034274 | Length: | 345 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001265486.1 | Gene: | WSB2 / 55884 | HGNCID: | 19222 | Length: | 421 | Species: | Homo sapiens |
Alignment Length: | 244 | Identity: | 70/244 - (28%) |
---|---|---|---|
Similarity: | 128/244 - (52%) | Gaps: | 25/244 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 71 LVSSSG--DRLLKLWDLSATRCIQSLAGHGDGVNDVAWSAAG--LIASCSDDMTVRLWDA-RSKL 130
Fly 131 CVKVLEGHSRYSFSCCFNPQANLLASTSFDETVRLWDVRTGKTLKIVHAHQDPITSVDFHRDGNI 195
Fly 196 FVTSSYDGLVRLWDSSTGHVLKTL--------VDVDNIPVGYVK---FSPNGRYILSSTLNNTLR 249
Fly 250 LW--NYKKPKCMRTYRGHLNEFYCSNSNFSTTGGIWIVSGSEDNTLCIW 296 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10931 | NP_611261.1 | WD40 | <48..341 | CDD:225201 | 70/244 (29%) |
WD40 | 49..341 | CDD:238121 | 70/244 (29%) | ||
WD40 repeat | 59..96 | CDD:293791 | 7/26 (27%) | ||
WD40 repeat | 102..137 | CDD:293791 | 11/37 (30%) | ||
WD40 repeat | 142..178 | CDD:293791 | 8/35 (23%) | ||
WD40 repeat | 185..220 | CDD:293791 | 16/42 (38%) | ||
WD40 repeat | 227..263 | CDD:293791 | 10/40 (25%) | ||
WD40 repeat | 271..309 | CDD:293791 | 8/26 (31%) | ||
WD40 repeat | 314..340 | CDD:293791 | |||
WSB2 | NP_001265486.1 | WD40 repeat | 46..106 | CDD:293791 | |
WD40 | 47..384 | CDD:225201 | 70/244 (29%) | ||
WD40 | 138..377 | CDD:238121 | 69/242 (29%) | ||
WD40 repeat | 174..212 | CDD:293791 | 11/37 (30%) | ||
WD40 repeat | 217..253 | CDD:293791 | 8/35 (23%) | ||
WD40 repeat | 261..306 | CDD:293791 | 17/44 (39%) | ||
WD40 repeat | 313..345 | CDD:293791 | 10/34 (29%) | ||
WD40 repeat | 353..389 | CDD:293791 | 8/29 (28%) | ||
SOCS_WSB_SWIP | 381..419 | CDD:239702 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0266 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |