DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10931 and AMBRA1

DIOPT Version :9

Sequence 1:	NP_611261.1	Gene:	CG10931 / 37024	FlyBaseID:	FBgn0034274	Length:	345	Species:	Drosophila melanogaster
Sequence 2:	NP_001254711.1	Gene:	AMBRA1 / 55626	HGNCID:	25990	Length:	1301	Species:	Homo sapiens

Alignment Length:	139	Identity:	37/139 - (26%)
Similarity:	71/139 - (51%)	Gaps:	8/139 - (5%)

- Green bases have known domain annotations that are detailed below.

  Fly   111 LIASCSDDMTVRLWDARSKLCVKVLEGHSRYSFSCCFNPQ-ANLLASTSFDETVRLWDVRTGKTL 174
            |:||...:..:.:.:.::..||..|.||.|..:...|:|. :.|:||...|..||:||:..|...
Human    67 LLASTHVNHNIYITEVKTGKCVHSLIGHRRTPWCVTFHPTISGLIASGCLDGEVRIWDLHGGSES 131

  Fly   175 KIVHAHQDPITSVDFHRDGNIFVTSSYDGLVRLWDSSTGH---VLKTLVDVDNIPVGYVKFSPNG 236
            ....:: :.|.|:.||....:.:.::.:. :..||.|...   |:||..:::.:.:  |:|.|.|
Human   132 WFTDSN-NAIASLAFHPTAQLLLIATANE-IHFWDWSRREPFAVVKTASEMERVRL--VRFDPLG 192

  Fly   237 RYILSSTLN 245
            .|:|::.:|
Human   193 HYLLTAIVN 201

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10931	NP_611261.1	WD40	<48..341	CDD:225201	37/139 (27%)
		WD40	49..341	CDD:238121	37/139 (27%)
		WD40 repeat	59..96	CDD:293791
		WD40 repeat	102..137	CDD:293791	6/25 (24%)
		WD40 repeat	142..178	CDD:293791	11/36 (31%)
		WD40 repeat	185..220	CDD:293791	9/37 (24%)
		WD40 repeat	227..263	CDD:293791	7/19 (37%)
		WD40 repeat	271..309	CDD:293791
		WD40 repeat	314..340	CDD:293791
AMBRA1	NP_001254711.1	WD40	<48..>198	CDD:225201	36/134 (27%)
		WD 1	51..90		5/22 (23%)
		WD40 repeat	56..92	CDD:293791	5/24 (21%)
		WD40	<59..198	CDD:295369	36/134 (27%)
		WD 2	93..133		14/39 (36%)
		WD40 repeat	99..135	CDD:293791	11/35 (31%)
		WD 3	135..175		8/41 (20%)
		WD40 repeat	140..176	CDD:293791	8/36 (22%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG0266
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900