DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10931 and AHI1

DIOPT Version :9

Sequence 1:NP_611261.1 Gene:CG10931 / 37024 FlyBaseID:FBgn0034274 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001128302.1 Gene:AHI1 / 54806 HGNCID:21575 Length:1196 Species:Homo sapiens


Alignment Length:357 Identity:92/357 - (25%)
Similarity:161/357 - (45%) Gaps:43/357 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ETEIAIPEAAFDSFKMPMLPSQ-FHLENSMSPGYAIKH--SL-LGHSGCVTGLKFSSNGENLVSS 74
            :||..:.|:. :..|...||.| ..:.|        ||  || .|..||.. |.||.||..|.::
Human   573 DTEPGLEESK-EVIKWKRLPGQACRIPN--------KHLFSLNAGERGCFC-LDFSHNGRILAAA 627

  Fly    75 SGDR---LLKLWDLSATRCIQSLAGHGDGVNDVAWSAAG-LIASCSDDMTVRLW--DARSKLCVK 133
            ...|   .:.|:::.:.|.::.|.||.:.:.|::||... .|.:.|.|.|.|:|  :..:....:
Human   628 CASRDGYPIILYEIPSGRFMRELCGHLNIIYDLSWSKDDHYILTSSSDGTARIWKNEINNTNTFR 692

  Fly   134 VLEGHSRYSFSCCFNPQANLLASTS-FDETVRLWDVRTGKTLKIV----HAHQDPITSVDFHRDG 193
            ||. |..:.::..|:|....|..|. :|..:|:|.|...:...|:    ..|:..|.|:.|..:|
Human   693 VLP-HPSFVYTAKFHPAVRELVVTGCYDSMIRIWKVEMREDSAILVRQFDVHKSFINSLCFDTEG 756

  Fly   194 NIFVTSSYDGLVRLWDS---------STGH--VLKTLVDVD--NIPVGYVKFSPNGRYILSSTLN 245
            :...:....|::.:|::         |..|  :.|.:.:.:  .||:.|::..|||:.:|..|.:
Human   757 HHMYSGDCTGVIVVWNTYVKINDLEHSVHHWTINKEIKETEFKGIPISYLEIHPNGKRLLIHTKD 821

  Fly   246 NTLRLWNYKKPKCMRTYRGHLNEFYCSNSNFSTTGGIWIVSGSEDNTLCIWNLQTRELVQKIS-- 308
            :|||:.:. :....|.:.|..|.....:|.. |..|.::.:||||..:.:||.:|.|.|...|  
Human   822 STLRIMDL-RILVARKFVGAANYREKIHSTL-TPCGTFLFAGSEDGIVYVWNPETGEQVAMYSDL 884

  Fly   309 TEGDQILSTHCHPTANVIASGALQNSYAIKIW 340
            .....|.....||..|::|..|...:..|.::
Human   885 PFKSPIRDISYHPFENMVAFCAFGQNEPILLY 916

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10931NP_611261.1 WD40 <48..341 CDD:225201 84/322 (26%)
WD40 49..341 CDD:238121 84/321 (26%)
WD40 repeat 59..96 CDD:293791 10/39 (26%)
WD40 repeat 102..137 CDD:293791 11/37 (30%)
WD40 repeat 142..178 CDD:293791 9/40 (23%)
WD40 repeat 185..220 CDD:293791 8/45 (18%)
WD40 repeat 227..263 CDD:293791 10/35 (29%)
WD40 repeat 271..309 CDD:293791 13/39 (33%)
WD40 repeat 314..340 CDD:293791 7/25 (28%)
AHI1NP_001128302.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 56..186
Interaction with HAP1. /evidence=ECO:0000269|PubMed:23532844 141..434
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 215..242
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 254..327
WD 1 607..649 12/42 (29%)
WD40 611..907 CDD:330360 77/299 (26%)
WD40 repeat 612..652 CDD:293791 11/40 (28%)
WD 2 652..691 11/38 (29%)
WD40 repeat 658..695 CDD:293791 10/36 (28%)
WD 3 695..735 9/40 (23%)
WD40 repeat 700..737 CDD:293791 9/36 (25%)
WD 4 742..781 7/38 (18%)
WD40 repeat 748..783 CDD:293791 5/34 (15%)
WD 5 797..837 12/40 (30%)
WD40 repeat 803..840 CDD:293791 10/37 (27%)
WD 6 841..880 13/39 (33%)
WD 7 885..926 7/32 (22%)
SH3_AHI-1 1055..1106 CDD:212746
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1115..1196
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0266
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.