DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10931 and Ahi1

DIOPT Version :9

Sequence 1:NP_611261.1 Gene:CG10931 / 37024 FlyBaseID:FBgn0034274 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_080479.2 Gene:Ahi1 / 52906 MGIID:87971 Length:1047 Species:Mus musculus


Alignment Length:372 Identity:99/372 - (26%)
Similarity:166/372 - (44%) Gaps:59/372 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ETAST---PG--DSETEIAIPEAAFDSFKMPMLPSQ-FHLENSMSPGYAIKH--SL-LGHSGCVT 60
            ||:|.   ||  ||:.|:          |...||.| ..:.|        ||  || .|..||..
Mouse   418 ETSSVDTEPGLEDSKEEV----------KWKRLPGQACRIPN--------KHLFSLNAGERGCFC 464

  Fly    61 GLKFSSNGENLVSSSGDR---LLKLWDLSATRCIQSLAGHGDGVNDVAWSAAG--LIASCSDDMT 120
             |.||.||..|.::...|   .:.|:::.:.|.::.|.||.:.:.|:.||...  |:.|.||. |
Mouse   465 -LDFSHNGRILAAACASRDGYPIILYEIPSGRFMRELCGHLNIIYDLDWSKDDRYLVTSSSDG-T 527

  Fly   121 VRLW--DARSKLCVKVLEGHSRYSFSCCFNPQANLLASTS-FDETVRLW--DVRTGKTLKI--VH 178
            .|:|  :..|....:||. |..:.::..|:|....|..|. :|..:|:|  |.|....:.:  :.
Mouse   528 ARVWKNEINSTSTFRVLP-HPSFVYTAKFHPATRELVVTGCYDSMIRIWKIDAREDAAILVRQLD 591

  Fly   179 AHQDPITSVDFHRDGNIFVTSSYDGLVRLWDS---------STGH--VLKTLVDVD--NIPVGYV 230
            .|:..:.|:.|..:|:...:....|::.:||:         |..|  :.|.:.:.:  .:|:.|:
Mouse   592 VHKSFVNSICFDDEGHHMYSGDCIGVIVVWDTYVKVNDVQHSVRHWTINKEIKETEFRGVPISYL 656

  Fly   231 KFSPNGRYILSSTLNNTLRLWNYKKPKCMRTYRGHLNEFYCSNSNFSTTGGIWIVSGSEDNTLCI 295
            :..|||:.:|..|.::|||:.:. :....|.:.|..|.....:|..:..|.: :.|||||..:.:
Mouse   657 EVHPNGKRLLIHTKDSTLRIMDL-RILAARKFVGAANYREKIHSTLTPCGTL-LFSGSEDGIVYV 719

  Fly   296 WNLQTRELVQKIS--TEGDQILSTHCHPTANVIASGALQNSYAIKIW 340
            ||.:|.|.|...|  .....|.....||..|::|..|...|..|.::
Mouse   720 WNPETGEQVAMYSDLPFKSTIRDISYHPLENMVAFCAFGQSEPILLY 766

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10931NP_611261.1 WD40 <48..341 CDD:225201 86/323 (27%)
WD40 49..341 CDD:238121 86/322 (27%)
WD40 repeat 59..96 CDD:293791 10/39 (26%)
WD40 repeat 102..137 CDD:293791 13/38 (34%)
WD40 repeat 142..178 CDD:293791 9/40 (23%)
WD40 repeat 185..220 CDD:293791 9/45 (20%)
WD40 repeat 227..263 CDD:293791 10/35 (29%)
WD40 repeat 271..309 CDD:293791 13/39 (33%)
WD40 repeat 314..340 CDD:293791 8/25 (32%)
Ahi1NP_080479.2 Interaction with HAP1. /evidence=ECO:0000250 1..284
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 67..181
WD40 447..>769 CDD:225201 87/333 (26%)
WD 1 457..499 12/42 (29%)
WD40 461..760 CDD:295369 79/303 (26%)
WD40 repeat 462..502 CDD:293791 11/40 (28%)
WD 2 502..541 13/39 (33%)
WD40 repeat 508..545 CDD:293791 12/37 (32%)
WD 3 545..585 10/40 (25%)
WD40 repeat 550..591 CDD:293791 9/40 (23%)
WD 4 592..631 7/38 (18%)
WD40 repeat 598..647 CDD:293791 9/48 (19%)
WD 5 648..687 11/39 (28%)
WD40 repeat 653..692 CDD:293791 11/39 (28%)
WD 6 691..730 13/39 (33%)
WD 7 735..776 8/32 (25%)
SH3_AHI-1 907..957 CDD:212746
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 963..1047
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0266
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.