DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10931 and DTL

DIOPT Version :9

Sequence 1:NP_611261.1 Gene:CG10931 / 37024 FlyBaseID:FBgn0034274 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_057532.4 Gene:DTL / 51514 HGNCID:30288 Length:730 Species:Homo sapiens


Alignment Length:395 Identity:90/395 - (22%)
Similarity:150/395 - (37%) Gaps:125/395 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 SQFHLENSMSPGYAI----KHSLLGHSGCVT---GLKFSS--NGENLVSSSGDR-LLKLWDLSA- 87
            ||:.|: |:..||..    :|:..|.:|...   |..|||  |.|::::.:.:. .::|::..: 
Human    21 SQYPLQ-SLLTGYQCSGNDEHTSYGETGVPVPPFGCTFSSAPNMEHVLAVANEEGFVRLYNTESQ 84

  Fly    88 ---TRCIQSLAGHGDGVNDVAWSAAGL-IASCSDDMTVRLWDARSKLCVKVLEGHSRYSFSCCFN 148
               .:|.:....|.:.|.|:||....| :.:.:.|.|.:.||.::...:...:||.....|..|:
Human    85 SFRKKCFKEWMAHWNAVFDLAWVPGELKLVTAAGDQTAKFWDVKAGELIGTCKGHQCSLKSVAFS 149

  Fly   149 P-QANLLASTSFDETVRLWDVRTGK-------TLKIVHAH-----QDP------------ITSVD 188
            . :..:..:...|..:.:||.|..|       ..:|..||     |.|            ..|||
Human   150 KFEKAVFCTGGRDGNIMVWDTRCNKKDGFYRQVNQISGAHNTSDKQTPSKPKKKQNSKGLAPSVD 214

  Fly   189 FH--------RDGNIFVTS-SYDGLVRLWD----------------------------------- 209
            |.        :|.|..|:: :.||::::||                                   
Human   215 FQQSVTVVLFQDENTLVSAGAVDGIIKVWDLRKNYTAYRQEPIASKSFLYPGSSTRKLGYSSLIL 279

  Fly   210 SSTGHVLKTLVDVDNI-----------PVG----------YVK--FSPNGRYILSSTLNNTLRLW 251
            .|||..|......|||           ||.          |||  .||:.::::|.:.:....:|
Human   280 DSTGSTLFANCTDDNIYMFNMTGLKTSPVAIFNGHQNSTFYVKSSLSPDDQFLVSGSSDEAAYIW 344

  Fly   252 NYKKP-KCMRTYRGHLNEF----YCSNSNFSTTGGIWIVSGSEDNTLCIWNLQTRELVQ-----K 306
            ....| :......||..|.    :|. |:|:.     |.:.|:||||.||.| .|.|.:     |
Human   345 KVSTPWQPPTVLLGHSQEVTSVCWCP-SDFTK-----IATCSDDNTLKIWRL-NRGLEEKPGGDK 402

  Fly   307 ISTEG 311
            :||.|
Human   403 LSTVG 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10931NP_611261.1 WD40 <48..341 CDD:225201 84/381 (22%)
WD40 49..341 CDD:238121 84/376 (22%)
WD40 repeat 59..96 CDD:293791 8/46 (17%)
WD40 repeat 102..137 CDD:293791 8/35 (23%)
WD40 repeat 142..178 CDD:293791 8/43 (19%)
WD40 repeat 185..220 CDD:293791 15/78 (19%)
WD40 repeat 227..263 CDD:293791 9/48 (19%)
WD40 repeat 271..309 CDD:293791 15/42 (36%)
WD40 repeat 314..340 CDD:293791
DTLNP_057532.4 WD 1 47..89 8/41 (20%)
WD40 55..389 CDD:238121 72/339 (21%)
WD40 repeat 55..96 CDD:293791 7/40 (18%)
WD 2 96..135 10/38 (26%)
WD40 repeat 101..137 CDD:293791 9/35 (26%)
WD 3 138..178 9/39 (23%)
WD40 repeat 144..197 CDD:293791 11/52 (21%)
DDB1-binding motif 168..171 2/2 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 188..210 4/21 (19%)
Nuclear localization signal. /evidence=ECO:0000255 197..203 1/5 (20%)
WD 4 214..253 9/38 (24%)
WD40 repeat 219..312 CDD:293791 16/92 (17%)
DDB1-binding motif 243..246 2/2 (100%)
WD40 repeat 264..304 CDD:293791 7/39 (18%)
WD 5 267..308 7/40 (18%)
WD 6 313..354 8/40 (20%)
WD40 repeat 320..356 CDD:293791 8/35 (23%)
WD 7 358..398 17/46 (37%)
WD40 repeat 363..388 CDD:293791 9/30 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 399..443 4/9 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 465..498
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 599..631
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 644..703
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.