DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10931 and nup37

DIOPT Version :9

Sequence 1:NP_611261.1 Gene:CG10931 / 37024 FlyBaseID:FBgn0034274 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001002619.1 Gene:nup37 / 436892 ZFINID:ZDB-GENE-040718-363 Length:326 Species:Danio rerio


Alignment Length:211 Identity:54/211 - (25%)
Similarity:93/211 - (44%) Gaps:37/211 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 HGDGVNDVAWSAAGLI---------ASCSDDMTVRLW--DARSKLCVKVLEGHSRYSFSCCFNP- 149
            ||..|:.:|||....:         ::.:.|..:|||  |.::...|||:|||:.|.....|.| 
Zfish    71 HGVRVDAIAWSPETHLDKLPPVIRFSTAAADRKIRLWTSDLQNSCDVKVMEGHTSYINHLVFEPA 135

  Fly   150 QANLLASTSFDETVRLWDVRTGKTLKIVHAHQDPITSVDFHRDGNI-FVTSSYDGLVRLWDSSTG 213
            :...:||.|.|.|.|:||:...:|...  ..:.|..||.:|.:.|. .:.:...|.:|.:|..|.
Zfish   136 EGKQIASVSDDHTCRVWDLDGNETTSF--RLRSPGVSVCWHPEDNCKLMVAEKKGTIRFYDLVTQ 198

  Fly   214 HVLKTLVDVDNIPVGYVKFSPNGRYILSSTLNNTLRLWNY--------KKPKCMRTYRGHLNE-- 268
            |.:.:| |...:|:....:.......:.:.:.|...:|:.        |:|       .|:::  
Zfish   199 HAILSL-DSGQVPLMSADWCLTNTIKVGAVVANDWVIWDITRSSYPLEKRP-------AHVDKAR 255

  Fly   269 -FYCSNSN---FSTTG 280
             |..|.:|   |:|||
Zfish   256 HFRWSRANENLFATTG 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10931NP_611261.1 WD40 <48..341 CDD:225201 54/211 (26%)
WD40 49..341 CDD:238121 54/211 (26%)
WD40 repeat 59..96 CDD:293791
WD40 repeat 102..137 CDD:293791 11/45 (24%)
WD40 repeat 142..178 CDD:293791 11/36 (31%)
WD40 repeat 185..220 CDD:293791 9/35 (26%)
WD40 repeat 227..263 CDD:293791 4/43 (9%)
WD40 repeat 271..309 CDD:293791 6/13 (46%)
WD40 repeat 314..340 CDD:293791
nup37NP_001002619.1 WD40 repeat 20..59 CDD:293791
WD40 30..237 CDD:295369 44/168 (26%)
WD40 <71..>277 CDD:225201 54/211 (26%)
WD40 repeat 77..122 CDD:293791 11/44 (25%)
WD40 repeat 128..164 CDD:293791 11/37 (30%)
WD40 repeat 168..205 CDD:293791 10/37 (27%)
WD40 repeat 212..241 CDD:293791 2/28 (7%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0266
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.