Sequence 1: | NP_611261.1 | Gene: | CG10931 / 37024 | FlyBaseID: | FBgn0034274 | Length: | 345 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001002619.1 | Gene: | nup37 / 436892 | ZFINID: | ZDB-GENE-040718-363 | Length: | 326 | Species: | Danio rerio |
Alignment Length: | 211 | Identity: | 54/211 - (25%) |
---|---|---|---|
Similarity: | 93/211 - (44%) | Gaps: | 37/211 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 97 HGDGVNDVAWSAAGLI---------ASCSDDMTVRLW--DARSKLCVKVLEGHSRYSFSCCFNP- 149
Fly 150 QANLLASTSFDETVRLWDVRTGKTLKIVHAHQDPITSVDFHRDGNI-FVTSSYDGLVRLWDSSTG 213
Fly 214 HVLKTLVDVDNIPVGYVKFSPNGRYILSSTLNNTLRLWNY--------KKPKCMRTYRGHLNE-- 268
Fly 269 -FYCSNSN---FSTTG 280 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10931 | NP_611261.1 | WD40 | <48..341 | CDD:225201 | 54/211 (26%) |
WD40 | 49..341 | CDD:238121 | 54/211 (26%) | ||
WD40 repeat | 59..96 | CDD:293791 | |||
WD40 repeat | 102..137 | CDD:293791 | 11/45 (24%) | ||
WD40 repeat | 142..178 | CDD:293791 | 11/36 (31%) | ||
WD40 repeat | 185..220 | CDD:293791 | 9/35 (26%) | ||
WD40 repeat | 227..263 | CDD:293791 | 4/43 (9%) | ||
WD40 repeat | 271..309 | CDD:293791 | 6/13 (46%) | ||
WD40 repeat | 314..340 | CDD:293791 | |||
nup37 | NP_001002619.1 | WD40 repeat | 20..59 | CDD:293791 | |
WD40 | 30..237 | CDD:295369 | 44/168 (26%) | ||
WD40 | <71..>277 | CDD:225201 | 54/211 (26%) | ||
WD40 repeat | 77..122 | CDD:293791 | 11/44 (25%) | ||
WD40 repeat | 128..164 | CDD:293791 | 11/37 (30%) | ||
WD40 repeat | 168..205 | CDD:293791 | 10/37 (27%) | ||
WD40 repeat | 212..241 | CDD:293791 | 2/28 (7%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0266 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |