DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10931 and Nup37

DIOPT Version :9

Sequence 1:NP_611261.1 Gene:CG10931 / 37024 FlyBaseID:FBgn0034274 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001262950.1 Gene:Nup37 / 43040 FlyBaseID:FBgn0039301 Length:320 Species:Drosophila melanogaster


Alignment Length:253 Identity:66/253 - (26%)
Similarity:111/253 - (43%) Gaps:24/253 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 TGLKFSSNGENLVSSSGDRLLKLW--DLSATRCIQSLAGHGDGVNDVAWSAAG-LIASCSDDMTV 121
            |.|..:.|...|.:::|.: |||:  ||.....:|.|.||||.||||:|...| |:||.|||.|.
  Fly    81 TSLNCTPNNVTLCAANGSQ-LKLYRTDLGQFTSLQVLRGHGDYVNDVSWVCDGELLASVSDDFTC 144

  Fly   122 RLWDARSKLCVKVLEGHSRYSFSCCFNPQ-ANLLASTSFDETVRLWDVRTGKTLKIVHAHQDPIT 185
            |.|.........:..|.|....|...:|: .|.:........:.|::|...:|:..|.:.:.|:.
  Fly   145 RFWTTTGGGENVITFGLSSAGMSVKSHPEDPNKVLVAEKKGIIHLYNVTLKQTVISVESPKFPLM 209

  Fly   186 SVDFHRDGNIFVTSSYDGLVRLWDSSTGHVLKTLVDVDNIPVGYVKFSP-NGRYILSSTLNNTLR 249
            |.|:.....:|:||...|.|..||.:..:|...:..|.......|:|:| :...:::..:..||:
  Fly   210 SADWAHSNRLFITSLAGGDVVTWDLNRPYVPADVKQVHEDCGRVVRFAPGSSEMVIAMVIGLTLK 274

  Fly   250 LWNYKKPKCMRTYRGHLNEFYCSNSNFSTTGGI-W-----IVSGSEDNTLCIWNLQTR 301
            ::..|....:            ..::..:.||: |     .:|...|..|..|.:|.:
  Fly   275 VFAAKSTVPL------------LEASLKSYGGMAWHQRLPYISAVSDRKLLFWKVQMK 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10931NP_611261.1 WD40 <48..341 CDD:225201 66/253 (26%)
WD40 49..341 CDD:238121 66/253 (26%)
WD40 repeat 59..96 CDD:293791 12/37 (32%)
WD40 repeat 102..137 CDD:293791 14/35 (40%)
WD40 repeat 142..178 CDD:293791 6/36 (17%)
WD40 repeat 185..220 CDD:293791 10/34 (29%)
WD40 repeat 227..263 CDD:293791 6/36 (17%)
WD40 repeat 271..309 CDD:293791 8/37 (22%)
WD40 repeat 314..340 CDD:293791
Nup37NP_001262950.1 WD40 71..320 CDD:295369 66/251 (26%)
WD40 <71..318 CDD:225201 65/249 (26%)
WD40 repeat 72..118 CDD:293791 12/37 (32%)
WD40 repeat 124..160 CDD:293791 14/35 (40%)
WD40 repeat 165..202 CDD:293791 6/36 (17%)
WD40 repeat 209..245 CDD:293791 10/35 (29%)
WD40 repeat 252..286 CDD:293791 6/45 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0266
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.