Sequence 1: | NP_611261.1 | Gene: | CG10931 / 37024 | FlyBaseID: | FBgn0034274 | Length: | 345 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001014201.1 | Gene: | Wdsub1 / 362137 | RGDID: | 1359296 | Length: | 476 | Species: | Rattus norvegicus |
Alignment Length: | 321 | Identity: | 74/321 - (23%) |
---|---|---|---|
Similarity: | 138/321 - (42%) | Gaps: | 82/321 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 89 RCIQSLAGHGDGVNDVAWSAAGLIASCSDDMTVRLWDAR--SKLCVKVLEGHSRYSFSCC-FNPQ 150
Fly 151 ANLLASTSFDETVRLWDVRTGKTLKIV-HAHQDPITSVDFHRDGNIFVTSSYDGLVRLWDSSTGH 214
Fly 215 VLKTLVDVDNIPVGYVK--------FSPNGRYILSSTLNNTLRLWNYKKPKCMRTYRGH-LNEFY 270
Fly 271 CSNSNFSTTGG-------------------IWIV------------------------------- 285
Fly 286 -----SGSEDNTLCIWNLQTRELVQKISTEGDQILSTHCHPTANVIASGALQNSYAIKIWK 341 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10931 | NP_611261.1 | WD40 | <48..341 | CDD:225201 | 73/319 (23%) |
WD40 | 49..341 | CDD:238121 | 73/319 (23%) | ||
WD40 repeat | 59..96 | CDD:293791 | 2/6 (33%) | ||
WD40 repeat | 102..137 | CDD:293791 | 12/36 (33%) | ||
WD40 repeat | 142..178 | CDD:293791 | 15/37 (41%) | ||
WD40 repeat | 185..220 | CDD:293791 | 7/34 (21%) | ||
WD40 repeat | 227..263 | CDD:293791 | 10/43 (23%) | ||
WD40 repeat | 271..309 | CDD:293791 | 13/92 (14%) | ||
WD40 repeat | 314..340 | CDD:293791 | 3/25 (12%) | ||
Wdsub1 | NP_001014201.1 | WD40 | 4..309 | CDD:238121 | 73/318 (23%) |
WD 1 | 10..47 | 15/37 (41%) | |||
WD40 repeat | 16..52 | CDD:293791 | 12/36 (33%) | ||
WD 2 | 52..91 | 17/39 (44%) | |||
WD40 repeat | 57..93 | CDD:293791 | 15/35 (43%) | ||
WD 3 | 95..134 | 8/47 (17%) | |||
WD40 repeat | 101..136 | CDD:293791 | 7/43 (16%) | ||
WD 4 | 137..176 | 9/39 (23%) | |||
WD40 repeat | 143..177 | CDD:293791 | 7/34 (21%) | ||
WD 5 | 178..228 | 9/49 (18%) | |||
WD40 repeat | 183..236 | CDD:293791 | 7/52 (13%) | ||
WD 6 | 237..276 | 6/38 (16%) | |||
WD40 repeat | 242..266 | CDD:293791 | 4/23 (17%) | ||
WD 7 | 279..318 | 5/33 (15%) | |||
WD40 repeat | 284..308 | CDD:293791 | 3/25 (12%) | ||
SAM_WDSUB1 | 328..399 | CDD:188904 | |||
U-box | 404..476 | CDD:398320 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D957291at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |