DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10931 and Wdr81

DIOPT Version :9

Sequence 1:NP_611261.1 Gene:CG10931 / 37024 FlyBaseID:FBgn0034274 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_609535.1 Gene:Wdr81 / 34616 FlyBaseID:FBgn0032395 Length:1953 Species:Drosophila melanogaster


Alignment Length:262 Identity:50/262 - (19%)
Similarity:111/262 - (42%) Gaps:41/262 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SFKMPMLPSQFHLENSMSPGYAIK------------------HSLLGHSGCVTGLKFSSNGENLV 72
            ::|:..:|...||:.:....:..:                  .|.:||:..|..:....|..:.:
  Fly  1610 AYKLDQMPKTRHLKGNWLAYWRNETTRNEKDTQTLNLKQIRLQSFVGHTNSVRAIYALDNENSFI 1674

  Fly    73 SSSGDRLLKLWDL-------SATRCIQSLAGHGDGVNDVAW-SAAGLIASCSDDMTVRLWDARSK 129
            |:|.|:.:|||.|       ..:.|..:...|...:|.:.: .:...:.||  |..:.|||....
  Fly  1675 SASKDKTVKLWSLRSEGDGRKTSACQFTYTAHKKSINSLGFLESLRYVVSC--DSGIHLWDPFIG 1737

  Fly   130 LCVKVLEG--HSRYSFSCCFNPQANLLASTSFDETVRLWDVRTGKTL---KIVHAH--QDPITSV 187
            ..:.||:.  ||..:...|....:.|:.:.:.:.||::.|.|:.:.:   ::.:|.  ...:..:
  Fly  1738 RPLSVLDAPRHSAVTVVKCLPSHSPLVIAGTAESTVKMVDARSCEYVNEWRVCNASLPNATVRCL 1802

  Fly   188 DFHRDGNIFVTSSYDGLVRLWDSSTGHVLKTL--VDVDNIPVGYVKFSPNGRYILSSTLNNTLRL 250
            .....||........|.:...|:.||.|:.:.  ::.|.:.:.    :|:.::::||.|:::|.:
  Fly  1803 AVAPSGNWLAAGLSSGCIVQLDTRTGMVINSWRPMECDLLQLA----APSDQFLVSSALDHSLAV 1863

  Fly   251 WN 252
            |:
  Fly  1864 WH 1865

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10931NP_611261.1 WD40 <48..341 CDD:225201 46/240 (19%)
WD40 49..341 CDD:238121 46/239 (19%)
WD40 repeat 59..96 CDD:293791 10/43 (23%)
WD40 repeat 102..137 CDD:293791 9/35 (26%)
WD40 repeat 142..178 CDD:293791 6/38 (16%)
WD40 repeat 185..220 CDD:293791 7/36 (19%)
WD40 repeat 227..263 CDD:293791 6/26 (23%)
WD40 repeat 271..309 CDD:293791
WD40 repeat 314..340 CDD:293791
Wdr81NP_609535.1 Beach 345..588 CDD:100117
WD40 <1644..1877 CDD:225201 46/228 (20%)
WD40 1651..1876 CDD:295369 46/221 (21%)
WD40 repeat 1662..1705 CDD:293791 9/42 (21%)
WD40 repeat 1710..1744 CDD:293791 8/35 (23%)
WD40 repeat 1752..1788 CDD:293791 6/35 (17%)
WD40 repeat 1799..1836 CDD:293791 7/36 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442355
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.