DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10931 and CG3436

DIOPT Version :9

Sequence 1:NP_611261.1 Gene:CG10931 / 37024 FlyBaseID:FBgn0034274 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001285543.1 Gene:CG3436 / 33180 FlyBaseID:FBgn0031229 Length:347 Species:Drosophila melanogaster


Alignment Length:342 Identity:83/342 - (24%)
Similarity:144/342 - (42%) Gaps:74/342 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 TEIAIPEAAFDSFKMPMLPSQFHLENS--MSPGYAIK-------------HSLLGHSGCVTGLKF 64
            :.:..|....:..:..:..::||.|..  :|.|:..:             .::.||||.|....|
  Fly    42 SNLQAPIMQLEGHEGEIFTAEFHPEGELLLSSGFDRQIYIWQVYEDCENVMAMSGHSGAVMEAHF 106

  Fly    65 SSNGENLVSSSGDRLLKLWDLSATRCIQSLAGHGDGVNDVAWSAAG--LIASCSDDMTVRLWDAR 127
            :.:|.::.:.|.|:.|..||::..:..:...|||:.||.|..|..|  |:.|.|||.|:::||||
  Fly   107 TPDGSHIFTCSTDKTLAFWDIATGQRQRRFKGHGNFVNSVQGSRRGQQLLCSGSDDRTIKIWDAR 171

  Fly   128 SKLCVKVLEGHSRYSFSCCFNPQANLLASTSFDETVRLWDVRTGKTLKIVHAHQDPITSVDFHRD 192
            .|.....||...:.: :.||......:.|...|..|::||:|....|..:..|.|.||.      
  Fly   172 KKHAAHTLESPFQVT-AVCFGDTGEQVISGGIDNEVKIWDIRKQAVLHHLRGHSDTITG------ 229

  Fly   193 GNIFVTSSYDGLVRLWDSSTGHVLKTLVDVDNIPVGYVKFSPNGRYILSSTLNNTLRLWNYKK-- 255
                                                 :..||.|.:||::.::||||:|:.:.  
  Fly   230 -------------------------------------MSLSPEGDFILTNAMDNTLRVWDVRPYA 257

  Fly   256 --PKCMRTYRGHLNEF-----YCSNSNFSTTGGIWIVSGSEDNTLCIWNLQTRELVQKISTEGDQ 313
              .:|::.::||.:.|     .|:.|    .|...|.|||.|..:.||::.||.::.|:......
  Fly   258 PGERCVKVFQGHQHNFEKNLLRCAWS----PGSDKITSGSADRHVYIWDVNTRRILYKLPGHNGS 318

  Fly   314 ILSTHCHPTANVIASGA 330
            :.:....|...:|.||:
  Fly   319 VNAVDFSPKEPLILSGS 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10931NP_611261.1 WD40 <48..341 CDD:225201 77/307 (25%)
WD40 49..341 CDD:238121 77/306 (25%)
WD40 repeat 59..96 CDD:293791 8/36 (22%)
WD40 repeat 102..137 CDD:293791 16/36 (44%)
WD40 repeat 142..178 CDD:293791 9/35 (26%)
WD40 repeat 185..220 CDD:293791 1/34 (3%)
WD40 repeat 227..263 CDD:293791 11/39 (28%)
WD40 repeat 271..309 CDD:293791 13/37 (35%)
WD40 repeat 314..340 CDD:293791 4/17 (24%)
CG3436NP_001285543.1 WD40 <19..346 CDD:225201 83/342 (24%)
WD40 50..342 CDD:238121 82/334 (25%)
WD40 repeat 58..96 CDD:293791 5/37 (14%)
WD40 repeat 102..138 CDD:293791 7/35 (20%)
WD40 repeat 143..180 CDD:293791 16/36 (44%)
WD40 repeat 186..221 CDD:293791 9/35 (26%)
WD40 repeat 227..267 CDD:293791 13/82 (16%)
WD40 repeat 277..313 CDD:293791 13/39 (33%)
WD40 repeat 319..342 CDD:293791 4/17 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442324
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.