DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10931 and Rbcn-3B

DIOPT Version :9

Sequence 1:NP_611261.1 Gene:CG10931 / 37024 FlyBaseID:FBgn0034274 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001284797.1 Gene:Rbcn-3B / 31155 FlyBaseID:FBgn0023510 Length:1525 Species:Drosophila melanogaster


Alignment Length:280 Identity:56/280 - (20%)
Similarity:102/280 - (36%) Gaps:68/280 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MELIETAS-----TPGDSETEIA---IPEAAFDSF------KMPMLPSQFHLENSMSPGYAIKH- 50
            |:|::.|.     ..||||..|:   :||...|:.      :||..|.:.|:..|:...::|.. 
  Fly   323 MKLLQGAGGQHNLLRGDSEGYISVWNVPEVPLDNISILQAKQMPPRPLKPHVCTSLVEAWSIMDP 387

  Fly    51 ---SLLGHSGCVT--GLKFSSN-----GENLVSSSGDRLLKLWDLSATRCIQSLAGHGDGVNDVA 105
               .:|.....:|  .:|.:|:     ...||....|..:.:...:.|..:|.|.|.....:|  
  Fly   388 PPVGILDQLSRITESPVKLTSSIYLPQQSRLVIGREDGSIVIVPATQTVMMQLLVGIKQNFSD-- 450

  Fly   106 WSAAGLI------ASC-------------------SDDMTVRLWDARS-----KLCVKVLEGHSR 140
            |.:..::      .:|                   ..|..|.|||..|     :.||     |:.
  Fly   451 WPSHQILYGHRGRVNCLLCPSMIHSRYEKSHLLSGGIDFAVCLWDLYSGSLLHRFCV-----HAG 510

  Fly   141 YSFSCCFNPQA------NLLASTSFDETVRLWDVRTGKTLKIVHAHQDPITSVDFHRDGNIFVTS 199
            ........|::      ..:.|.:.|.:|.|..::..|.:.:...|..|:.::.:....:..:..
  Fly   511 EITQLLVPPESCSPRILKCICSVASDHSVTLVSLQERKCVTLASRHLFPVVTIKWRPLDDFLIVG 575

  Fly   200 SYDGLVRLWDSSTGHVLKTL 219
            ..||.|.:|...|||:.:.|
  Fly   576 CSDGSVYVWQMETGHLDRVL 595

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10931NP_611261.1 WD40 <48..341 CDD:225201 40/219 (18%)
WD40 49..341 CDD:238121 39/218 (18%)
WD40 repeat 59..96 CDD:293791 9/43 (21%)
WD40 repeat 102..137 CDD:293791 11/64 (17%)
WD40 repeat 142..178 CDD:293791 6/41 (15%)
WD40 repeat 185..220 CDD:293791 8/35 (23%)
WD40 repeat 227..263 CDD:293791
WD40 repeat 271..309 CDD:293791
WD40 repeat 314..340 CDD:293791
Rbcn-3BNP_001284797.1 WD40 <11..>204 CDD:225201
WD40 repeat 20..63 CDD:293791
WD40 <22..202 CDD:295369
WD40 repeat 68..107 CDD:293791
WD40 repeat 118..152 CDD:293791
WD40 repeat 160..204 CDD:293791
WD40 repeat 212..251 CDD:293791
WD40 repeat 406..459 CDD:293791 10/54 (19%)
WD40 <449..>607 CDD:225201 28/154 (18%)
WD40 453..>597 CDD:295369 26/148 (18%)
WD40 repeat 513..555 CDD:293791 6/41 (15%)
WD40 repeat 560..596 CDD:293791 8/36 (22%)
WD40 <1395..>1469 CDD:225201
WD40 <1399..1495 CDD:295369
WD40 repeat 1439..1466 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442357
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.