DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10931 and Nup37

DIOPT Version :9

Sequence 1:NP_611261.1 Gene:CG10931 / 37024 FlyBaseID:FBgn0034274 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001100245.1 Gene:Nup37 / 299706 RGDID:1307774 Length:326 Species:Rattus norvegicus


Alignment Length:207 Identity:53/207 - (25%)
Similarity:89/207 - (42%) Gaps:29/207 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 HGDGVNDVAW-------SAAGLIASCSD--DMTVRLW--DARSKLCVKVLEGHSRYSFSCCFNP- 149
            ||..|:.:||       |...:|..|:.  ||.:||:  |.:.|...|||||||.:.....|:| 
  Rat    71 HGVRVDGIAWSPETKLDSLPPVIKFCTSAADMKIRLFTSDLQDKNEYKVLEGHSDFINDLVFHPR 135

  Fly   150 QANLLASTSFDETVRLWDVRTGKTLKIVHAH---QDPITSVDFHRDGNI-FVTSSYDGLVRLWDS 210
            :...:||.|.|.|.|:|.:...:|     ||   ..|..||.:|.:... .:.:..:|.:|.:|.
  Rat   136 EGQEIASVSDDHTCRIWSLEGKQT-----AHFLLHSPGMSVCWHPEETFKLMVAEKNGTIRFYDL 195

  Fly   211 STGHVLKTLVDVDNIPVGYVKFSPNGRYILSSTLNNTLRLWNYKK---PKCMRTY---RGHLNEF 269
            .....:.:| ..:..|:....:.....:.:.:...|...:|:..:   |:..|..   |.|...:
  Rat   196 MAQQAILSL-QSEQTPLMSAHWCLKNTFKVGAVAGNDWIIWDITRSSYPQETRPVHMDRAHSFRW 259

  Fly   270 YCSNSN-FSTTG 280
            ...:.| |:|||
  Rat   260 SAISENLFATTG 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10931NP_611261.1 WD40 <48..341 CDD:225201 53/207 (26%)
WD40 49..341 CDD:238121 53/207 (26%)
WD40 repeat 59..96 CDD:293791
WD40 repeat 102..137 CDD:293791 14/45 (31%)
WD40 repeat 142..178 CDD:293791 10/36 (28%)
WD40 repeat 185..220 CDD:293791 6/35 (17%)
WD40 repeat 227..263 CDD:293791 4/41 (10%)
WD40 repeat 271..309 CDD:293791 5/11 (45%)
WD40 repeat 314..340 CDD:293791
Nup37NP_001100245.1 WD40 repeat 22..70 CDD:293791
WD40 <64..260 CDD:421866 48/194 (25%)
WD40 repeat 76..122 CDD:293791 14/45 (31%)
WD40 repeat 127..163 CDD:293791 12/40 (30%)
WD40 repeat 170..205 CDD:293791 7/35 (20%)
WD40 repeat 211..248 CDD:293791 3/36 (8%)
WD40 repeat 291..322 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0266
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.