| Sequence 1: | NP_611261.1 | Gene: | CG10931 / 37024 | FlyBaseID: | FBgn0034274 | Length: | 345 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_056441.6 | Gene: | WSB1 / 26118 | HGNCID: | 19221 | Length: | 421 | Species: | Homo sapiens |
| Alignment Length: | 269 | Identity: | 68/269 - (25%) |
|---|---|---|---|
| Similarity: | 120/269 - (44%) | Gaps: | 42/269 - (15%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 56 SGCVT----GLKFSSNGENLVSSSGDRLLKLWDLSATRCIQSLAGHGDGVNDVAWSAAG--LIAS 114
Fly 115 CSDDMTVRLWDARSK-LCVKVLEGHSRYSFSCCFNPQANLLASTSFDETVRLWDVRTGKTLKIVH 178
Fly 179 AHQDPITSVDFHRDGNIFVTSSYDGLVRLWDSSTGHVLKTLVDVDNIP------------VGYVK 231
Fly 232 FSPNGRYILSSTLNNTLRLWNYKKPKCMRTYRGHLNEFY------CSNS---NFSTTGGIWIVSG 287
Fly 288 SEDNTLCIW 296 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG10931 | NP_611261.1 | WD40 | <48..341 | CDD:225201 | 68/269 (25%) |
| WD40 | 49..341 | CDD:238121 | 68/269 (25%) | ||
| WD40 repeat | 59..96 | CDD:293791 | 7/40 (18%) | ||
| WD40 repeat | 102..137 | CDD:293791 | 12/37 (32%) | ||
| WD40 repeat | 142..178 | CDD:293791 | 9/35 (26%) | ||
| WD40 repeat | 185..220 | CDD:293791 | 13/34 (38%) | ||
| WD40 repeat | 227..263 | CDD:293791 | 8/35 (23%) | ||
| WD40 repeat | 271..309 | CDD:293791 | 9/29 (31%) | ||
| WD40 repeat | 314..340 | CDD:293791 | |||
| WSB1 | NP_056441.6 | WD 1 | 32..71 | ||
| WD40 | 38..382 | CDD:225201 | 68/269 (25%) | ||
| WD40 repeat | 59..105 | CDD:293791 | |||
| WD 2 | 124..165 | 8/40 (20%) | |||
| WD40 | 135..388 | CDD:238121 | 65/258 (25%) | ||
| WD 3 | 168..208 | 11/39 (28%) | |||
| WD40 repeat | 174..212 | CDD:293791 | 12/37 (32%) | ||
| WD 4 | 212..251 | 11/38 (29%) | |||
| WD40 repeat | 217..253 | CDD:293791 | 9/35 (26%) | ||
| WD 5 | 254..293 | 14/38 (37%) | |||
| WD40 repeat | 261..299 | CDD:293791 | 13/37 (35%) | ||
| WD 6 | 309..346 | 10/49 (20%) | |||
| WD40 repeat | 314..353 | CDD:293791 | 10/51 (20%) | ||
| SOCS_WSB1_SWIP1 | 382..421 | CDD:239715 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG0266 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||