DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10931 and tup11

DIOPT Version :9

Sequence 1:NP_611261.1 Gene:CG10931 / 37024 FlyBaseID:FBgn0034274 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_592873.1 Gene:tup11 / 2542299 PomBaseID:SPAC18B11.10 Length:614 Species:Schizosaccharomyces pombe


Alignment Length:309 Identity:78/309 - (25%)
Similarity:146/309 - (47%) Gaps:32/309 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LGHSGCVTGLKFSSNGENLVSSSGDRLLKLWDLSATRCIQSLAGHGDG--------VNDVAWSAA 109
            |.|...|..:|||:||:.|.:.. ::...::|:...:.:.:|  |.:.        |..:|:|..
pombe   310 LEHPSVVCCVKFSNNGKYLATGC-NQAANVFDVQTGKKLFTL--HEESPDPSRDLYVRTIAFSPD 371

  Fly   110 G-LIASCSDDMTVRLWDARSKLCVKVLEGHSRYSFSCCFNPQANLLASTSFDETVRLWDVRTGKT 173
            | .:.:.::|..::|||..::....|..||.:..:|..|:.....:.|.|.|.|.|||||.||:.
pombe   372 GKYLVTGTEDRQIKLWDLSTQKVRYVFSGHEQDIYSLDFSHNGRFIVSGSGDRTARLWDVETGQC 436

  Fly   174 LKIVHAHQDPITSVDFHRDGNIFVTSSYDGLVRLWDSSTGHVLKTLVDVDNIPVGYVKFSPNGRY 238
            :..:.. ::.:|::....:.......|.|.::|:| |.:|.:::.| :.....|..:.|||:...
pombe   437 ILKLEI-ENGVTAIAISPNDQFIAVGSLDQIIRVW-SVSGTLVERL-EGHKESVYSIAFSPDSSI 498

  Fly   239 ILSSTLNNTLRLWNYK----------KPK--CMRTYRGHLNEFYCSNSNFSTTGGIWIVSGSEDN 291
            :||.:|:.|:::|..:          ||:  |..||.|| .:|..|.:  .:....|.:|||:|.
pombe   499 LLSGSLDKTIKVWELQATRSVGLSAIKPEGICKATYTGH-TDFVLSVA--VSPDSRWGLSGSKDR 560

  Fly   292 TLCIWNLQTRELVQKISTEGDQILSTHCHPTANVIASGALQNSYAIKIW 340
            ::..|:|||.:.........:.::|....|.....|||:  .....:||
pombe   561 SMQFWDLQTGQSYLTCQGHKNSVISVCFSPDGRQFASGS--GDLRARIW 607

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10931NP_611261.1 WD40 <48..341 CDD:225201 78/309 (25%)
WD40 49..341 CDD:238121 78/309 (25%)
WD40 repeat 59..96 CDD:293791 9/36 (25%)
WD40 repeat 102..137 CDD:293791 8/35 (23%)
WD40 repeat 142..178 CDD:293791 13/35 (37%)
WD40 repeat 185..220 CDD:293791 7/34 (21%)
WD40 repeat 227..263 CDD:293791 13/47 (28%)
WD40 repeat 271..309 CDD:293791 10/37 (27%)
WD40 repeat 314..340 CDD:293791 5/25 (20%)
tup11NP_592873.1 Tup_N 9..86 CDD:285748
WD40 <303..610 CDD:225201 78/309 (25%)
WD40 306..608 CDD:238121 78/309 (25%)
WD40 repeat 316..358 CDD:293791 10/44 (23%)
WD40 repeat 364..400 CDD:293791 8/35 (23%)
WD40 repeat 405..441 CDD:293791 13/35 (37%)
WD40 repeat 447..481 CDD:293791 8/35 (23%)
WD40 repeat 487..535 CDD:293791 13/47 (28%)
WD40 repeat 541..577 CDD:293791 10/37 (27%)
WD40 repeat 583..607 CDD:293791 5/25 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0266
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.