DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10931 and wdr-5.3

DIOPT Version :9

Sequence 1:NP_611261.1 Gene:CG10931 / 37024 FlyBaseID:FBgn0034274 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001024299.1 Gene:wdr-5.3 / 179489 WormBaseID:WBGene00013862 Length:501 Species:Caenorhabditis elegans


Alignment Length:338 Identity:141/338 - (41%)
Similarity:219/338 - (64%) Gaps:11/338 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 STPGDSETEIAIPEAAFDSFKMPMLPSQFHLENSMSP---GYAIKHSLLGHSGCVTGLKFSSNGE 69
            :|...|..::|.|       :.|:.|:......:..|   .:::..::.||:..|:.:|||..|:
 Worm   169 TTKPTSTIQVAPP-------RDPVAPTTSSSGITKKPENGEFSLVKTISGHTKSVSVIKFSYCGK 226

  Fly    70 NLVSSSGDRLLKLWDLSATRCIQSLAGHGDGVNDVAWSA-AGLIASCSDDMTVRLWDARSKLCVK 133
            .|.:.|.|:.:|:|:......:|:||.|..|:||.:||: :..|||.|||.||:::|..|..|::
 Worm   227 YLGTGSADKQIKVWNTVDMTYLQTLASHQLGINDFSWSSNSQFIASASDDTTVKIFDVISGACLR 291

  Fly   134 VLEGHSRYSFSCCFNPQANLLASTSFDETVRLWDVRTGKTLKIVHAHQDPITSVDFHRDGNIFVT 198
            .:.||:.|.|.|.||||::|:||..||||||:||.:||..:|.:.||.|||||:.::.|||...|
 Worm   292 TMRGHTNYVFCCSFNPQSSLIASAGFDETVRVWDFKTGLCVKCIPAHSDPITSISYNHDGNTMAT 356

  Fly   199 SSYDGLVRLWDSSTGHVLKTLVDVDNIPVGYVKFSPNGRYILSSTLNNTLRLWNYKKPKCMRTYR 263
            |||||.:|:||:::|..||||||.|:.||.:|.|||||:|:||:.|:::|:||:.||.|.::.|.
 Worm   357 SSYDGCIRVWDAASGSCLKTLVDTDHAPVTFVCFSPNGKYLLSAQLDSSLKLWDPKKAKPLKYYN 421

  Fly   264 GHLNEFYCSNSNFSTTGGIWIVSGSEDNTLCIWNLQTRELVQKISTEGDQILSTHCHPTANVIAS 328
            ||.|:.||..:|.|...|..|:|||||..:.:|::||:::||.:......:|:|..|||.|:|||
 Worm   422 GHKNKKYCLFANMSVPLGKHIISGSEDGRILVWSIQTKQIVQILEGHTTPVLATDSHPTLNIIAS 486

  Fly   329 GALQNSYAIKIWK 341
            |.|:....|:||:
 Worm   487 GGLEPDNVIRIWR 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10931NP_611261.1 WD40 <48..341 CDD:225201 133/293 (45%)
WD40 49..341 CDD:238121 133/292 (46%)
WD40 repeat 59..96 CDD:293791 12/36 (33%)
WD40 repeat 102..137 CDD:293791 15/35 (43%)
WD40 repeat 142..178 CDD:293791 20/35 (57%)
WD40 repeat 185..220 CDD:293791 18/34 (53%)
WD40 repeat 227..263 CDD:293791 17/35 (49%)
WD40 repeat 271..309 CDD:293791 15/37 (41%)
WD40 repeat 314..340 CDD:293791 12/25 (48%)
wdr-5.3NP_001024299.1 WD40 <200..501 CDD:225201 134/300 (45%)
WD40 205..499 CDD:238121 133/293 (45%)
WD40 repeat 216..253 CDD:293791 12/36 (33%)
WD40 repeat 259..295 CDD:293791 15/35 (43%)
WD40 repeat 300..336 CDD:293791 20/35 (57%)
WD40 repeat 343..378 CDD:293791 18/34 (53%)
WD40 repeat 385..421 CDD:293791 17/35 (49%)
WD40 repeat 429..466 CDD:293791 15/36 (42%)
WD40 repeat 472..498 CDD:293791 12/25 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157524
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D368256at33208
OrthoFinder 1 1.000 - - FOG0002159
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.