| Sequence 1: | NP_611261.1 | Gene: | CG10931 / 37024 | FlyBaseID: | FBgn0034274 | Length: | 345 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001121684.1 | Gene: | WDSUB1 / 151525 | HGNCID: | 26697 | Length: | 476 | Species: | Homo sapiens |
| Alignment Length: | 312 | Identity: | 74/312 - (23%) |
|---|---|---|---|
| Similarity: | 133/312 - (42%) | Gaps: | 64/312 - (20%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 89 RCIQSLAGHGDGVNDVAWSAAGLIASCSDDMTVRLWDAR--SKLCVKVLEGHSRYSFSCCFNPQA 151
Fly 152 NLLASTSFDETVRLWDVRTGKTLKIVHAHQ-DPITSVDFHRDGNIFVTSSYDGLVRLWDSSTGHV 215
Fly 216 LKTLVDVDNIPVGYVKFSPNGRYILSSTLNNTLRLWNYKKPKCMRTYRGH-LNEFYCSNSNFSTT 279
Fly 280 GG-------------------IWI------------------------------------VSGSE 289
Fly 290 DNTLCIWNLQTRELVQKISTEGDQILSTHCHPTANVIASGALQNSYAIKIWK 341 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG10931 | NP_611261.1 | WD40 | <48..341 | CDD:225201 | 73/310 (24%) |
| WD40 | 49..341 | CDD:238121 | 73/310 (24%) | ||
| WD40 repeat | 59..96 | CDD:293791 | 2/6 (33%) | ||
| WD40 repeat | 102..137 | CDD:293791 | 14/36 (39%) | ||
| WD40 repeat | 142..178 | CDD:293791 | 14/35 (40%) | ||
| WD40 repeat | 185..220 | CDD:293791 | 8/34 (24%) | ||
| WD40 repeat | 227..263 | CDD:293791 | 9/35 (26%) | ||
| WD40 repeat | 271..309 | CDD:293791 | 12/92 (13%) | ||
| WD40 repeat | 314..340 | CDD:293791 | 3/25 (12%) | ||
| WDSUB1 | NP_001121684.1 | WD40 | <2..308 | CDD:225201 | 72/309 (23%) |
| WD40 | 4..309 | CDD:238121 | 73/309 (24%) | ||
| WD 1 | 10..47 | 17/37 (46%) | |||
| WD40 repeat | 16..52 | CDD:293791 | 14/36 (39%) | ||
| WD 2 | 52..91 | 15/38 (39%) | |||
| WD40 repeat | 57..93 | CDD:293791 | 14/35 (40%) | ||
| WD 3 | 95..134 | 9/39 (23%) | |||
| WD40 repeat | 101..135 | CDD:293791 | 8/34 (24%) | ||
| WD 4 | 137..176 | 10/39 (26%) | |||
| WD40 repeat | 142..177 | CDD:293791 | 9/35 (26%) | ||
| WD 5 | 178..228 | 8/49 (16%) | |||
| WD40 repeat | 183..236 | CDD:293791 | 6/52 (12%) | ||
| WD 6 | 237..276 | 6/38 (16%) | |||
| WD40 repeat | 242..266 | CDD:293791 | 5/23 (22%) | ||
| WD 7 | 279..318 | 5/33 (15%) | |||
| WD40 repeat | 284..326 | CDD:293791 | 5/28 (18%) | ||
| SAM_WDSUB1 | 328..399 | CDD:188904 | |||
| SAM | 332..395 | CDD:197735 | |||
| U-box | 404..476 | CDD:252675 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D957291at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.010 | |||||