| Sequence 1: | NP_611261.1 | Gene: | CG10931 / 37024 | FlyBaseID: | FBgn0034274 | Length: | 345 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_775750.3 | Gene: | WDR88 / 126248 | HGNCID: | 26999 | Length: | 472 | Species: | Homo sapiens |
| Alignment Length: | 306 | Identity: | 75/306 - (24%) |
|---|---|---|---|
| Similarity: | 126/306 - (41%) | Gaps: | 68/306 - (22%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 52 LLGHSGCVTGLKFSSNGENLVSSSGDRLLKLWDL---SATRCIQSLAGHGDGVNDVAWSAAG--- 110
Fly 111 LIASCSDDMTVRLWDARS---------------------------------KLCVK--------- 133
Fly 134 -VLEGHSRYSFSCCFNPQANLLASTSFDETVRLWDVRTGKT-LKIVHAHQDPITSVDFHRDGNIF 196
Fly 197 VTSSYDGLVRLWDSSTGH-----VLKTLVDVDNIPVGYVKFSPNGRYILSSTLNNTLRLWNYKKP 256
Fly 257 KCMRTYRGH---LNEFYCSNSNFSTTGGIWIVSGSEDNTLCIWNLQ 299 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG10931 | NP_611261.1 | WD40 | <48..341 | CDD:225201 | 75/306 (25%) |
| WD40 | 49..341 | CDD:238121 | 75/306 (25%) | ||
| WD40 repeat | 59..96 | CDD:293791 | 12/39 (31%) | ||
| WD40 repeat | 102..137 | CDD:293791 | 11/80 (14%) | ||
| WD40 repeat | 142..178 | CDD:293791 | 15/36 (42%) | ||
| WD40 repeat | 185..220 | CDD:293791 | 10/39 (26%) | ||
| WD40 repeat | 227..263 | CDD:293791 | 5/35 (14%) | ||
| WD40 repeat | 271..309 | CDD:293791 | 10/29 (34%) | ||
| WD40 repeat | 314..340 | CDD:293791 | |||
| WDR88 | NP_775750.3 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..22 | ||
| WD40 | 96..391 | CDD:238121 | 73/302 (24%) | ||
| WD40 | 97..>398 | CDD:225201 | 75/306 (25%) | ||
| WD 1 | 100..139 | 13/38 (34%) | |||
| WD40 repeat | 106..142 | CDD:293791 | 11/39 (28%) | ||
| WD 2 | 143..182 | 10/38 (26%) | |||
| WD40 repeat | 148..181 | CDD:293791 | 10/32 (31%) | ||
| WD 3 | 184..224 | 1/39 (3%) | |||
| WD40 repeat | 190..226 | CDD:293791 | 1/35 (3%) | ||
| WD 4 | 228..267 | 15/38 (39%) | |||
| WD40 repeat | 233..270 | CDD:293791 | 15/36 (42%) | ||
| WD 5 | 271..310 | 12/38 (32%) | |||
| WD40 repeat | 276..317 | CDD:293791 | 11/40 (28%) | ||
| WD 6 | 319..358 | 5/38 (13%) | |||
| WD40 repeat | 324..348 | CDD:293791 | 4/23 (17%) | ||
| WD 7 | 361..400 | 12/39 (31%) | |||
| WD40 repeat | 366..390 | CDD:293791 | 8/29 (28%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 447..472 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG0266 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||