DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10931 and ambra1a

DIOPT Version :9

Sequence 1:NP_611261.1 Gene:CG10931 / 37024 FlyBaseID:FBgn0034274 Length:345 Species:Drosophila melanogaster
Sequence 2:XP_002667715.3 Gene:ambra1a / 100332642 ZFINID:ZDB-GENE-111104-2 Length:1344 Species:Danio rerio


Alignment Length:139 Identity:40/139 - (28%)
Similarity:70/139 - (50%) Gaps:8/139 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 LIASCSDDMTVRLWDARSKLCVKVLEGHSRYSFSCCFNP-QANLLASTSFDETVRLWDVRTGKTL 174
            |:||...:..:.:.:.:|..||..|.||.|..:...|:| ...|:||...|..||:||:..|...
Zfish    66 LMASTHVNHNIYITEVKSGKCVHSLVGHRRTPWCLTFHPIIPGLIASGCLDGEVRIWDLHGGSES 130

  Fly   175 KIVHAHQDPITSVDFHRDGNIFVTSSYDGLVRLWDSSTGH---VLKTLVDVDNIPVGYVKFSPNG 236
            .:..:: ..|.|:.||....:.:.:: :..|.|||.|...   |:||..:.:.:.:  |:|.|.|
Zfish   131 WLTESN-SAIASLAFHPTAQLLLIAT-NNEVHLWDWSRKEPFTVVKTASETERVRL--VRFDPLG 191

  Fly   237 RYILSSTLN 245
            .|:|::.:|
Zfish   192 HYLLTAIVN 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10931NP_611261.1 WD40 <48..341 CDD:225201 40/139 (29%)
WD40 49..341 CDD:238121 40/139 (29%)
WD40 repeat 59..96 CDD:293791
WD40 repeat 102..137 CDD:293791 7/25 (28%)
WD40 repeat 142..178 CDD:293791 11/36 (31%)
WD40 repeat 185..220 CDD:293791 11/37 (30%)
WD40 repeat 227..263 CDD:293791 7/19 (37%)
WD40 repeat 271..309 CDD:293791
WD40 repeat 314..340 CDD:293791
ambra1aXP_002667715.3 WD40 <43..>197 CDD:225201 39/134 (29%)
WD40 <58..197 CDD:295369 39/134 (29%)
WD40 repeat 58..91 CDD:293791 6/24 (25%)
WD40 repeat 98..134 CDD:293791 11/35 (31%)
WD40 repeat 139..175 CDD:293791 10/36 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0266
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.