Sequence 1: | NP_611261.1 | Gene: | CG10931 / 37024 | FlyBaseID: | FBgn0034274 | Length: | 345 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_003201394.2 | Gene: | wdr90 / 100038787 | ZFINID: | ZDB-GENE-070424-67 | Length: | 1843 | Species: | Danio rerio |
Alignment Length: | 402 | Identity: | 82/402 - (20%) |
---|---|---|---|
Similarity: | 143/402 - (35%) | Gaps: | 127/402 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 41 SMSPGYAIKHSLLGHSGCVTGLKFSSNGENLVS--SSGDRLLKLWDLSATRCIQSLAGHGDGVND 103
Fly 104 VAWS-AAGLIASCSDD----MTVRLWDAR---SKLCVKVL-EGHSRYSFSCCFNPQANLLASTSF 159
Fly 160 DET---------VRLWDVRTG----------------------------------KTLKIVHAHQ 181
Fly 182 DPITSVDF--------------------HRDGNIF------------------VTSSYDGLVRLW 208
Fly 209 DSSTGHVLKTLVDVDNI--------PVGYVKFSPNGRYILSSTLNNTLRLWNYKKPKCMRTYRGH 265
Fly 266 LNEFYCSNSNFSTTG-GIWIVSGSEDNTLCIWNLQT-RELVQKISTEGDQILSTHCHPTANVIAS 328
Fly 329 GALQNSYAIKIW 340 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10931 | NP_611261.1 | WD40 | <48..341 | CDD:225201 | 80/395 (20%) |
WD40 | 49..341 | CDD:238121 | 80/394 (20%) | ||
WD40 repeat | 59..96 | CDD:293791 | 10/38 (26%) | ||
WD40 repeat | 102..137 | CDD:293791 | 12/43 (28%) | ||
WD40 repeat | 142..178 | CDD:293791 | 12/78 (15%) | ||
WD40 repeat | 185..220 | CDD:293791 | 11/72 (15%) | ||
WD40 repeat | 227..263 | CDD:293791 | 8/35 (23%) | ||
WD40 repeat | 271..309 | CDD:293791 | 10/39 (26%) | ||
WD40 repeat | 314..340 | CDD:293791 | 7/25 (28%) | ||
wdr90 | XP_003201394.2 | DUF667 | 7..197 | CDD:282825 | |
WD40 | 302..790 | CDD:225201 | 75/373 (20%) | ||
WD40 | <450..689 | CDD:295369 | 49/247 (20%) | ||
WD40 repeat | 457..495 | CDD:293791 | 10/37 (27%) | ||
WD40 repeat | 502..536 | CDD:293791 | 9/33 (27%) | ||
WD40 repeat | 552..594 | CDD:293791 | 10/41 (24%) | ||
WD40 | 670..1000 | CDD:295369 | 37/162 (23%) | ||
WD40 repeat | 670..701 | CDD:293791 | 9/40 (23%) | ||
WD40 repeat | 707..742 | CDD:293791 | 9/38 (24%) | ||
WD40 repeat | 746..784 | CDD:293791 | 10/37 (27%) | ||
WD40 repeat | 792..827 | CDD:293791 | 7/26 (27%) | ||
WD40 | 818..1330 | CDD:225201 | |||
WD40 repeat | 833..869 | CDD:293791 | |||
WD40 repeat | 933..969 | CDD:293791 | |||
WD40 | 965..1314 | CDD:295369 | |||
WD40 repeat | 976..1013 | CDD:293791 | |||
WD40 repeat | 1211..1245 | CDD:293791 | |||
WD40 | <1214..1574 | CDD:225201 | |||
WD40 | 1241..1557 | CDD:295369 | |||
WD40 repeat | 1251..1292 | CDD:293791 | |||
WD40 repeat | 1297..1365 | CDD:293791 | |||
WD40 repeat | 1392..1426 | CDD:293791 | |||
WD40 repeat | 1480..1528 | CDD:293791 | |||
WD40 | 1491..1790 | CDD:295369 | |||
WD40 | 1519..>1841 | CDD:225201 | |||
WD40 repeat | 1533..1569 | CDD:293791 | |||
WD40 repeat | 1576..1619 | CDD:293791 | |||
WD40 repeat | 1625..1661 | CDD:293791 | |||
WD40 repeat | 1668..1717 | CDD:293791 | |||
WD40 repeat | 1777..1809 | CDD:293791 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0266 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |