DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir54a and Ir75b

DIOPT Version :9

Sequence 1:NP_611259.2 Gene:Ir54a / 37022 FlyBaseID:FBgn0034272 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001137966.2 Gene:Ir75b / 8673994 FlyBaseID:FBgn0261402 Length:605 Species:Drosophila melanogaster


Alignment Length:311 Identity:62/311 - (19%)
Similarity:99/311 - (31%) Gaps:103/311 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 TEYRSLESSTIFDKDFPNMHGHPLTVMPDQWLPRSVLYVDRRTGKQILAGSVGRFF-HVLSWKLN 225
            |:::.|.|....:.||.|.:...|.|..|....:|...:|..:.|        ||| |...|   
  Fly    42 TQFQPLHSDIQLNDDFLNHNILKLGVFLDINCDKSGTVLDMASAK--------RFFSHRYHW--- 95

  Fly   226 ATLQLSKKVTTGRFLNATALKELSESFSVDVPASLTIME-------------------------- 264
                    :...|.:|.:.|:...:...:.|.|.:|.:.                          
  Fly    96 --------LIYDRSMNFSVLESHFKEAQIFVDADVTYVTHDPFSKNFLLYDVYNKGRQLGGELNI 152

  Fly   265 -------------RVEQLAS--------------TSYPMEVTHVCLMVPVARRIPIKDIYFILSS 302
                         |||:..|              |...|..|.|...:|:  .:.||:|:..::|
  Fly   153 TADREIFCNKTNCRVERYLSELYTRSALQHRKSFTGLTMRATAVVTALPL--NVSIKEIFDFMNS 215

  Fly   303 ASNMFLAIVIVSSYGLALNLLRNMTHRDVRLVDFVLNDK-----ALRGILGQSF-------NLPL 355
            ...:.|.......| .|...||:|.  |.:. .::..|:     |..|::|...       ..|.
  Fly   216 KYRIQLDTYARLGY-QARQPLRDML--DCKF-KYIFRDRWSDGNATGGMIGDLILDKADLAIAPF 276

  Fly   356 SRSFSTRLIFLMLGIVGLNVSSIFGAGLDTLMAHPPRQFQARSFAGLRRTK 406
            ..||. |.:||.    .:...|:|   .:..|...||...    |||..|:
  Fly   277 IYSFD-RALFLQ----PITKFSVF---REICMFRNPRSVS----AGLSATE 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir54aNP_611259.2 None
Ir75bNP_001137966.2 Periplasmic_Binding_Protein_Type_2 253..553 CDD:304360 18/75 (24%)
Lig_chan 343..585 CDD:278489
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.