DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir54a and Ir92a

DIOPT Version :9

Sequence 1:NP_611259.2 Gene:Ir54a / 37022 FlyBaseID:FBgn0034272 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001097845.2 Gene:Ir92a / 42415 FlyBaseID:FBgn0038789 Length:678 Species:Drosophila melanogaster


Alignment Length:355 Identity:74/355 - (20%)
Similarity:117/355 - (32%) Gaps:134/355 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 CPYNWAKDIFE-NQTI---PVVVLSDSETFINIRMFSRPLHVACLPGHELQKDLALLENFTSSLM 103
            |.|||...|.| :.||   .|.:|..:.                          |.|.::.:::|
  Fly   340 CIYNWYDGITETSHTIARSSVTILGPAP--------------------------APLPSWRTNIM 378

  Fly   104 DFPSQKKIVYISNNFSDPTRMDYIFETCYHRRIWNIVGLLASDEHRYFYRYHLYPSFRTEY---- 164
            .|.::..:|.||.                         |:......||.:   |.|:|..|    
  Fly   379 PFNNRAWLVLIST-------------------------LVICGTFLYFMK---YVSYRLRYSGTQ 415

  Fly   165 ------RSLESSTIFDKD----FPNMHGHPLTVMPDQWLPRSVLYVDRRTGKQILAGSVGRFFHV 219
                  |.||.|.:   |    |......||:.  |::.|                    |||  
  Fly   416 VKFHHSRKLEKSML---DIFALFIQQPSAPLSF--DRFAP--------------------RFF-- 453

  Fly   220 LSWKLNATLQLS-------KKVTTGRFLNA---TALKELSESFSVDVPASLTIMERVEQLASTSY 274
            |:..|.||:.|.       |.:.|..|.:|   |..|.....:....| |:..:..|:     |.
  Fly   454 LATILCATITLENIYSGQLKSMLTFPFYSAPVDTIEKWAQSGWKWSAP-SIIWVHTVQ-----SS 512

  Fly   275 PMEVTHVCLMVPVARRIPIKDIYFILSSASNMFLAIVIVSSYGLALNLLRNMTHRDVRLVDFVLN 339
            .:|...:     :||...:.| |..||:.|.|       .:||..   :..::...:.:.|:| :
  Fly   513 DLETEQI-----LARNFEVHD-YSYLSNVSFM-------PNYGFG---IERLSSGSLSVGDYV-S 560

  Fly   340 DKAL--RGILGQSFNLPLSRSFSTRLIFLM 367
            .:||  |.:|........:|:.|.|...||
  Fly   561 TEALENRIVLHDDLYFDYTRAVSIRGWILM 590



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.