DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir54a and Ir60a

DIOPT Version :9

Sequence 1:NP_611259.2 Gene:Ir54a / 37022 FlyBaseID:FBgn0034272 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_611901.1 Gene:Ir60a / 37881 FlyBaseID:FBgn0034994 Length:716 Species:Drosophila melanogaster


Alignment Length:260 Identity:54/260 - (20%)
Similarity:84/260 - (32%) Gaps:77/260 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   360 STRLIFLMLGIVGLNVSSIFGAGLDTLMAHPPRQFQARSFAGLRRTKIPLVTTEEDFPTWMKLRV 424
            :|||.|:.|.:.||||.:.:.:.:......|....|......:....||....||. ..|.:...
  Fly   443 TTRLFFMALTLYGLNVVATYTSKMIATFQDPGYLHQLDELTEVVAAGIPFGGHEES-RDWFENDD 506

  Fly   425 PMLVVNVSEYNHLRNGRNTSNAYFASRLYWNLFSEQQKRFTRELFIYSTDDCLWSLALLSFQWP- 488
            .|.:.         ||.|.|..          |..|.|....   :.....|:.|..:.:.|.| 
  Fly   507 DMWIF---------NGYNISPE----------FIPQSKNLEA---VKWGQRCILSNRMYTMQSPL 549

  Fly   489 -------QNSLFTEPVSQL-------ILEVNA-------NGLY-----DFWVGMHYYDMTAAGLS 527
                   .|::|:.||..:       :.|:|:       .|::     ||.....|       |:
  Fly   550 ADVIYAFPNNVFSSPVQMIMKAGFPFLFEMNSIIRLMRDVGIFQKIDADFRYNNTY-------LN 607

  Fly   528 GLEDPSLQLKE------REH---PTSLRIVDFQWMWQAYGTFMVIAILVFLLEVSWHRITSLFVS 583
            .:.....|..|      .||   |..:.:|...|           |.|.|:.|:..||..:..||
  Fly   608 RINKMRPQFPETAIVLTTEHLKGPFFILVVGSCW-----------AALTFIGELIIHRWRTQLVS 661

  Fly   584  583
              Fly   662  661



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.