DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir54a and Ir56b

DIOPT Version :9

Sequence 1:NP_611259.2 Gene:Ir54a / 37022 FlyBaseID:FBgn0034272 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_611430.1 Gene:Ir56b / 37250 FlyBaseID:FBgn0034456 Length:408 Species:Drosophila melanogaster


Alignment Length:463 Identity:97/463 - (20%)
Similarity:176/463 - (38%) Gaps:126/463 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 HRYFYR--YHLYPSFRTEYRSLESSTIFDKDFPNMHGHPLTVMPDQWLP-RSVLYVDRRTGKQIL 209
            |.:.:.  ..:.|.|...|..:.      |.|..::.:.|.:...:.|| :||:..|        
  Fly    22 HAFIFNETQFVVPKFCGPYMEIV------KHFAEVYHYQLFLDSLESLPKKSVVEQD-------- 72

  Fly   210 AGSVGRFFHVLSWKLNATLQ--LSKKVTTGRFLNATALKELSESFSVDVPASLTIMERVEQLAST 272
                     ::|.|.|.:|.  :.:...|..|.|||                           ..
  Fly    73 ---------IISGKYNLSLHGVIIRPEETSDFFNAT---------------------------QH 101

  Fly   273 SYPMEVTHVCLMVPVARRIPIKDIYFILSSASNMFLAIVIVSSYGLALNLLR--------NMTHR 329
            |||:|:...|:|||:|..:| |.:|.:......::..:.:.:.| :|| |||        |.|..
  Fly   102 SYPLELMTNCVMVPLAPELP-KWMYMVWPLGKYIWTCLFLGTFY-VAL-LLRYVHWREPGNATRS 163

  Fly   330 DVRLVDFVLNDKALRGILGQSFNLPLS---RSFSTRLI--FLMLGIVG-------------LNVS 376
            ..|   .||:..||   |..|.|:.:|   :..|.|:|  :.:|.|.|             .::.
  Fly   164 YTR---NVLHAMAL---LMFSANMNMSVKLKHASIRVIIFYTLLYIFGFILTNYHLSHMTAFDMK 222

  Fly   377 SIFGAGLDTLMAHPPRQFQARSFAGLRRTKIPLVTTE---EDFPTWMKLRVPMLVVNVSEYNHLR 438
            .:|...:||             ::.|..:::.:|..:   |:. .|:.:           |..|.
  Fly   223 PVFLRPIDT-------------WSDLIHSRLRIVIHDSLLEEL-RWLPV-----------YQALL 262

  Fly   439 NGRNTSNAYFASRLYWNLFSEQQKRFTRELFIYSTDDCLWSLALLSFQWPQNSLFTEPVSQLILE 503
            ...:.|.||..::..|..|:.|||...:..| :.:..|...| ..:.....|:.|.:.:::.||.
  Fly   263 ASPSRSYAYVVTQDAWLFFNRQQKVLIQPYF-HLSKVCFGGL-FNALPMASNASFADSLNKFILN 325

  Fly   504 VNANGLYDFWVGMHYYDMTAAGLSGLEDPSLQLKEREHPTSLRIVDFQWMWQAYGTFMVIAILVF 568
            |...||:::|..:.:.....||.:.:...:..::    |.:|......|:..:.|  :.|:.|.|
  Fly   326 VWQAGLWNYWEELAFRYAEQAGYAKVFLDTYPVE----PLNLEFFTTAWIVLSAG--IPISSLAF 384

  Fly   569 LLEVSWHR 576
            .||:..||
  Fly   385 CLELFIHR 392



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.