DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir54a and Ir11a

DIOPT Version :9

Sequence 1:NP_611259.2 Gene:Ir54a / 37022 FlyBaseID:FBgn0034272 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_572795.2 Gene:Ir11a / 32189 FlyBaseID:FBgn0030385 Length:642 Species:Drosophila melanogaster


Alignment Length:316 Identity:63/316 - (19%)
Similarity:112/316 - (35%) Gaps:105/316 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 SYPME-VTHVCLMVPVA-RRIPIKD-IYFILSSASNMFLAIVIVSSYGLAL-NLLRNMTHRDVRL 333
            |:|:| :..|.:..|:. .|:|.|. :.::|  ||.|.|.:|:..:|...| ::||...||    
  Fly   398 SHPIEDLLTVIVGNPIPDHRLPGKGFLRYLL--ASWMLLTLVLRCAYQARLFDVLRLSRHR---- 456

  Fly   334 VDFVLNDKALRGILGQSFNLPLSRSFSTRLIFLMLGIVGLNVSSIFGAGLD----TLMAHPPRQF 394
                                ||.:..|        |::..|.:.:.....|    .|....|..|
  Fly   457 --------------------PLPKDLS--------GLIKDNYTMVANGYHDFYPLELTCRQPLDF 493

  Fly   395 QARSFAGLRRTKIPLVTTEEDFPTWMKLRVPMLVVNVSEYNHLRNGRNTSNAYFASRLYWNLFSE 459
            .|| |..::|     ...:|      :|....|:.|::.:||  ...|.|...|.          
  Fly   494 SAR-FERVQR-----AAPDE------RLTTIALISNLAYWNH--KHPNISRLTFV---------- 534

  Fly   460 QQKRFTRELFIYSTDDCLWSLALLSFQWPQNSLFTEPVSQLILEVNANGLYDFWVGMHYYDMTAA 524
            :|..:...|.||               :|:.......:.:.|.::                ::|.
  Fly   535 RQPIYMYHLVIY---------------FPRRFFLRPAIDRKIKQL----------------LSAG 568

  Fly   525 GLSGLEDPSLQLKER-----EHPTSLRIVDFQWMWQAY---GTFMVIAILVFLLEV 572
            .::.:|...:|.:.:     ..|..||.:....|..||   |..:|:|..:|:||:
  Fly   569 VMAHIERRYMQYENKRKVASNDPVLLRRITKSIMNGAYRIHGLVIVLATGMFILEL 624

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir54aNP_611259.2 None
Ir11aNP_572795.2 Periplasmic_Binding_Protein_Type_2 306..>356 CDD:304360
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.