DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir54a and Ir10a

DIOPT Version :9

Sequence 1:NP_611259.2 Gene:Ir54a / 37022 FlyBaseID:FBgn0034272 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001096949.1 Gene:Ir10a / 32067 FlyBaseID:FBgn0083979 Length:609 Species:Drosophila melanogaster


Alignment Length:448 Identity:97/448 - (21%)
Similarity:168/448 - (37%) Gaps:106/448 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 RRIWNIVGLLASDEHRYFYRYHL-------YPSFRTE-------YRSLESSTIFDKDFPNMHGHP 184
            |::|.        :|:.:.|:.|       |..|:..       .|...|.|:....|.:|.|:|
  Fly   136 RQLWT--------QHKVYNRFFLTRDGVWIYDPFKRRDSAFGRLVRYYGSETLDKLLFRDMAGYP 192

  Fly   185 LTVMPDQWLPRSVLYV----DRRTGKQILAGSVGRFF---HVLSWKLNATL---QLSKKVTTGRF 239
            |.:.    :.||| |.    |:.||  :|....|..|   .:|..:||.|:   |..||....|.
  Fly   193 LRIQ----MFRSV-YTRPEFDKETG--LLTRVTGVDFLVAQMLRERLNFTMLLQQPEKKYFGERS 250

  Fly   240 LNATALKELSESFSVDVPASLT-------IMERVEQLASTSYPMEVTHVCLMVPVARRIPIKDIY 297
            .|.:....:.......:...||       ::::........|..|   :|:.||.|.||| :.|.
  Fly   251 ANGSYNGAIGSIIKDGLDICLTGFFVKDYLVQQYMDFTVAVYDDE---LCIYVPKASRIP-QSIL 311

  Fly   298 FILSSASNMFLAIVIVSSYGLALNLLRNMTHRDVRLVDFVLNDKAL--RGILGQSFNL------- 353
            .|.:...:::|..|: :::..||..|      .:|:::..|...:|  :.|:||:..:       
  Fly   312 PIFAVGYDIWLGFVL-TAFACALIWL------TLRVINLKLRIVSLGNQHIVGQALGIMVDTWVV 369

  Fly   354 -------PLSRSFSTRLIFLMLGIVGLNVSSIFGAGLDTLMAHP-----PRQFQARSFAGLR--- 403
                   .|..|::.|:....|.:|.:...:||.:.|.|:..||     ....|....:||:   
  Fly   370 WVRLNLSHLPASYAERMFIGTLCLVSVIFGAIFESSLATVYIHPLYYKDINTMQELDESGLKVVY 434

  Fly   404 -----------RTKIPLVTTEEDFPTWMK-LRVPMLVVNVSEYNHLRNGRNTSNAYFASRLYWNL 456
                       ....||..:.....:|.: ||..:    :.|....||....|.       |.:|
  Fly   435 KYSSMADDLFFSETSPLFASLNKKLSWNRDLRADV----IDEVARFRNKAGVSR-------YTSL 488

  Fly   457 FSEQQKRFTRELFIYSTDDCLWSLALLSFQWPQNSLFTEPVSQLILEVNANGLYDFWV 514
            ..| ...||....|:...:|. ....:|:..|::|.:.:.|:.|:|.....||...|:
  Fly   489 ILE-SSHFTLLRKIWVVPECP-KYYTISYVMPRDSPWEDAVNALLLRFLNAGLIVKWI 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir54aNP_611259.2 None
Ir10aNP_001096949.1 Periplasmic_Binding_Protein_Type_2 220..>294 CDD:304360 13/73 (18%)
TM_PBP1_branched-chain-AA_like 315..>411 CDD:294309 20/102 (20%)
Lig_chan 319..587 CDD:278489 50/246 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.