DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIG-A and ALG11

DIOPT Version :9

Sequence 1:NP_001286547.1 Gene:PIG-A / 37020 FlyBaseID:FBgn0034270 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_014350.1 Gene:ALG11 / 855679 SGDID:S000004993 Length:548 Species:Saccharomyces cerevisiae


Alignment Length:307 Identity:53/307 - (17%)
Similarity:108/307 - (35%) Gaps:95/307 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 AVDTALFTPDPQQRPSNDIINIVVASRLVYRKGIDLLAGIIPRFKNTPN----INFIIVGDGPKR 237
            |:..|.|.|:.:.:       :::.|...:             .||.|:    |..|:.|....:
Yeast   309 AIVLAQFRPEKRHK-------LIIESFATF-------------LKNLPDSVSPIKLIMAGSTRSK 353

  Fly   238 DLLEEIREKTNMQERVQMVG----AVEHN----RVRDFLVRGHIFLNTSLTEAYCMAIVEAASCG 294
            .....::...:..|.|..:.    :.|.|    ::...|.:....:|....|.:.:|:||..:.|
Yeast   354 QDENYVKSLQDWSENVLKIPKHLISFEKNLPFDKIEILLNKSTFGVNAMWNEHFGIAVVEYMASG 418

  Fly   295 L-QVVSTSVGGIPEVLPKSLILLAEPEIDAIYAAILIAIDRHRKSSFKVSPSVGNGHLA-SDANG 357
            | .:|..|.|.:.::                                 |:|...||::. :....
Yeast   419 LIPIVHASAGPLLDI---------------------------------VTPWDANGNIGKAPPQW 450

  Fly   358 KVKRRRRRKVDTPISPTQLPAVSAPPADQNSSTEPVMCPYRCNELVETLYNWEDVALRTVKV-YD 421
            :::::...|::.....|..........|.|::.:|:..|           |..|:.|:..|: ||
Yeast   451 ELQKKYFAKLEDDGETTGFFFKEPSDPDYNTTKDPLRYP-----------NLSDLFLQITKLDYD 504

  Fly   422 --RVLNERS-----FTTSELVF-AVWQHGSWFLVFFVVAHFLMRLLE 460
              ||:..|:     :..|:|.| ..|::        .|.:.:.:|||
Yeast   505 CLRVMGARNQQYSLYKFSDLKFDKDWEN--------FVLNPICKLLE 543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIG-ANP_001286547.1 RfaB 1..309 CDD:223515 26/144 (18%)
GT1_PIG-A_like 2..451 CDD:99970 49/296 (17%)
ALG11NP_014350.1 GT4_ALG11-like 72..529 CDD:340835 48/283 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.