DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIG-A and GSY1

DIOPT Version :9

Sequence 1:NP_001286547.1 Gene:PIG-A / 37020 FlyBaseID:FBgn0034270 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_116670.1 Gene:GSY1 / 850569 SGDID:S000001911 Length:708 Species:Saccharomyces cerevisiae


Alignment Length:281 Identity:59/281 - (20%)
Similarity:109/281 - (38%) Gaps:71/281 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 ENTV------LRARVAKHRVSVIPNAVDTALFTPDPQQRPSNDIINI---VVASRLVYRKGIDLL 213
            ||||      :..|:.:|.:....|.:::.|.|...:...|::.:.:   |:|.|..|       
Yeast   379 ENTVNEVTASIGKRIFEHTMRYPHNGLESELPTNLDELLKSSEKVLLKKRVLALRRPY------- 436

  Fly   214 AGIIPRFKNTPNINFIIVGDG--PKRDLLEEIREKTNMQERVQMVGAVE----HNRV----RDFL 268
             |.:|     |.:...:..|.  |..:.:..:|...:..:||:::...|    :|.:    .|..
Yeast   437 -GELP-----PVVTHNMCDDANDPILNQIRHVRLFNDSSDRVKVIFHPEFLNANNPILGLDYDEF 495

  Fly   269 VRG-HIFLNTSLTEAYCMAIVEAASCGLQVVSTSVGGIPEVLPKSLILLAEPEIDAIYAAILIAI 332
            ||| |:.:..|..|.:.....|....|:..::|:|.|....: :.||...:.:...||     .:
Yeast   496 VRGCHLGVFPSYYEPWGYTPAECTVMGVPSITTNVSGFGAYM-EDLIETDQAKDYGIY-----IV 554

  Fly   333 DRHRKSSFKVSPSVGNGHLASDANGKVKRRRRRKVDTPISPTQLPAVSAPPADQNSSTEPVMCPY 397
            ||..|     ||......||......|.:.||:::                 :|.:.||      
Yeast   555 DRRFK-----SPDESVEQLADYMEEFVNKTRRQRI-----------------NQRNRTE------ 591

  Fly   398 RCNELVETLYNWEDVALRTVK 418
            |.::|::    |:.:.|..||
Yeast   592 RLSDLLD----WKRMGLEYVK 608

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIG-ANP_001286547.1 RfaB 1..309 CDD:223515 36/170 (21%)
GT1_PIG-A_like 2..451 CDD:99970 59/281 (21%)
GSY1NP_116670.1 Glycogen_syn 12..683 CDD:399009 59/281 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.