DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIG-A and Alg1

DIOPT Version :9

Sequence 1:NP_001286547.1 Gene:PIG-A / 37020 FlyBaseID:FBgn0034270 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_650662.1 Gene:Alg1 / 42146 FlyBaseID:FBgn0038552 Length:446 Species:Drosophila melanogaster


Alignment Length:226 Identity:42/226 - (18%)
Similarity:75/226 - (33%) Gaps:60/226 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 VCYNQCILPTAVCNV--------------------PMLRAVLLRERV--EVVHGHSAFSALAHEA 106
            |||..|.:......:                    |::|.|...||.  ...|.|...:....|.
  Fly   115 VCYLYCAVTRTKLAIDWHNYTYTVLALGMSKGEQSPLIRLVRRLERYFGSKAHTHFCVTRAMQED 179

  Fly   107 LMVGSLLGLKTVFTDHSLFGFADLSAALTNNLLEVNLGMVNHAICVSH-------IGKENTVLRA 164
            |.....:|...|..|.:...|                    |.|.::|       :.|:....:|
  Fly   180 LQQNWGIGPVKVLYDRAPAQF--------------------HPIDLTHKHELYLKLAKDYPQFQA 224

  Fly   165 RVAKHRVSVIPNAVDTALFTPDPQQRPSNDIINIVVASRLVYRKGIDLLAGIIPRFKNT------ 223
            :.|:....:...|:...|.:...|.||....: :|.::.....:...:|...:..::.|      
  Fly   225 KDAEQSDVLEATALTQKLASGVVQYRPQRQAV-LVSSTSWTPDEDFGILLKALQAYEETAQAEPL 288

  Fly   224 --PNINFIIVGDGPKRD-LLEEIREKTNMQE 251
              |::..||.|.||::: .:.|| ||...|:
  Fly   289 VYPSLLCIITGKGPQKEHYVAEI-EKLQWQK 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIG-ANP_001286547.1 RfaB 1..309 CDD:223515 42/226 (19%)
GT1_PIG-A_like 2..451 CDD:99970 42/226 (19%)
Alg1NP_650662.1 GT1_ALG1_like 6..442 CDD:99986 42/226 (19%)
PLN02275 7..402 CDD:215155 42/226 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0438
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.