DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIG-A and GlyS

DIOPT Version :9

Sequence 1:NP_001286547.1 Gene:PIG-A / 37020 FlyBaseID:FBgn0034270 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_731967.2 Gene:GlyS / 41823 FlyBaseID:FBgn0266064 Length:709 Species:Drosophila melanogaster


Alignment Length:386 Identity:75/386 - (19%)
Similarity:118/386 - (30%) Gaps:148/386 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 LLGLKTVFTDHSLFGFADLSAALT---NNL------LEVNLGMVNHAICVSHIGKENTVLRARVA 167
            |:.:.||||.|:......|.|..|   |||      .|.....:.|..|:.           |.|
  Fly   226 LVEIATVFTTHATLLGRYLCAGNTDFYNNLDKFAVDEEAGKRQIYHRYCLE-----------RGA 279

  Fly   168 KHRVSVIPNAVDTALFTPDPQQRPSNDIINIVVASRLVYRKGIDLLAGIIPRFKNTPNINFIIVG 232
            .|...|.....:...:..:...:...|||                          |||      |
  Fly   280 THLAHVFTTVSEITGYEAEHLLKRKPDII--------------------------TPN------G 312

  Fly   233 DGPKRDLLEEIREKTNMQERVQMVGAVEHNRVRDFLVRGHIFLNTSLTEAYCMAIVEAASCGLQV 297
            ...|:  ...|.|..|:.       ||...::.:| ||||.:                       
  Fly   313 LNVKK--FSAIHEFQNLH-------AVAKEKINEF-VRGHFY----------------------- 344

  Fly   298 VSTSVGGIPEVLPKSLILL-----------AEPEIDAIYAAILIAIDRHRKS-----SFKVSPSV 346
                 |.|...|.|:|...           |:..|:|:  |.|.|:.:|.|.     :|.:.|:.
  Fly   345 -----GHIDFDLDKTLYFFIAGRYEFGNKGADIFIEAL--ARLNAMLKHEKPDTTVVAFLIFPTK 402

  Fly   347 GN--------GH-----LASDANGKVKRRRRRKVDTPISPTQLPAVSAPPADQNSSTEPVMCPYR 398
            .|        ||     |....|...:...:|..||.:..      :.|.||.....:.::...|
  Fly   403 TNNFNVDSLRGHAVIKQLRDTINNVQQAVGKRMFDTCLQG------NIPNADDLLQKDDLVKIKR 461

  Fly   399 CNELVE-------TLYN----WEDVALRTVK-------VYDR---VLNERSFTTSELVFAV 438
            |...::       |.:|    |.|..|.:::       .:||   |.:....|::..:|.:
  Fly   462 CMFAMQRDSMPPVTTHNVADDWNDPVLSSIRRCHLFNSRHDRVKMVFHPEFLTSTNPLFGI 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIG-ANP_001286547.1 RfaB 1..309 CDD:223515 39/205 (19%)
GT1_PIG-A_like 2..451 CDD:99970 75/386 (19%)
GlySNP_731967.2 Glycogen_syn 53..697 CDD:399009 75/386 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0438
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.