DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIG-A and Alg11

DIOPT Version :9

Sequence 1:NP_001286547.1 Gene:PIG-A / 37020 FlyBaseID:FBgn0034270 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_001262182.1 Gene:Alg11 / 40402 FlyBaseID:FBgn0037108 Length:475 Species:Drosophila melanogaster


Alignment Length:139 Identity:33/139 - (23%)
Similarity:51/139 - (36%) Gaps:42/139 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 INFIIVGDGPKRDLLEEIREKTNMQE---------RVQMVGAVEHNRVRDFLVRGHIFLNTSLTE 281
            |..:|||.....|..|.::   |||:         .||....|.:..:.......||.::|...|
  Fly   319 IKLVIVGSCRNEDDYERLK---NMQDLTKHLSLENNVQFSVNVPYEDLLKLYQTAHIGIHTMWNE 380

  Fly   282 AYCMAIVEAASCGLQVVSTSVGGIPEVLPKSLILLAEPEIDAIYAAILIAIDRHRKSSFKVSPSV 346
            .:.:.|||:.:.||.:|:...||              |.:|.:                :.|...
  Fly   381 HFGIGIVESMAAGLIMVAHKSGG--------------PLLDIV----------------ETSAGS 415

  Fly   347 GNGHLASDA 355
            .||.||:||
  Fly   416 QNGFLATDA 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIG-ANP_001286547.1 RfaB 1..309 CDD:223515 24/91 (26%)
GT1_PIG-A_like 2..451 CDD:99970 33/139 (24%)
Alg11NP_001262182.1 PLN02949 24..473 CDD:215511 33/139 (24%)
GT1_ALG11_like 44..463 CDD:99978 33/139 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452347
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0438
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.