DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIG-A and GYS2

DIOPT Version :9

Sequence 1:NP_001286547.1 Gene:PIG-A / 37020 FlyBaseID:FBgn0034270 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_068776.2 Gene:GYS2 / 2998 HGNCID:4707 Length:703 Species:Homo sapiens


Alignment Length:359 Identity:70/359 - (19%)
Similarity:127/359 - (35%) Gaps:96/359 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 LRAVLLRERVEVVHGHSAFSALAHEALMVGSLLG------LKTVFTDHSLFGFADLSAALTNNLL 139
            |.|..|:|..:...|....:........:|.:|.      :.|:||.|        :..|...|.
Human   158 LTAWFLKEVTDHADGKYVVAQFHEWQAGIGLILSRARKLPIATIFTTH--------ATLLGRYLC 214

  Fly   140 EVNLGMVNHAICVSHIGKENTVLRARVAKHRVSVIPNAVDTA-LFTPDPQQRPSNDIINIVVASR 203
            ..|:...|| :...:|.||   ...|...||..:...:|..| :||...:       |..:.|..
Human   215 AANIDFYNH-LDKFNIDKE---AGERQIYHRYCMERASVHCAHVFTTVSE-------ITAIEAEH 268

  Fly   204 LVYRKGIDLLAGIIPRFKNTPN-INFIIVGDGPKRDLLEEIREKTNMQERVQMVGAVEHNRVRDF 267
            ::.||. |::         ||| :|.                :|.:.....|.:.|:...|::||
Human   269 MLKRKP-DVV---------TPNGLNV----------------KKFSAVHEFQNLHAMYKARIQDF 307

  Fly   268 LVRGHIF--LNTSLTEAYCMAIV---EAASCGLQVVSTSVGGIPEVLPKSLILLAEPEIDAIYAA 327
             ||||.:  |:..|.:...:.|.   |.::.|..:...|:..:     ..|:.:.:.:|..:...
Human   308 -VRGHFYGHLDFDLEKTLFLFIAGRYEFSNKGADIFLESLSRL-----NFLLRMHKSDITVMVFF 366

  Fly   328 ILIAIDRHRKSSFKVSPSVGNGHLAS--DANGKVKRRRRRKVDTPISPTQLPAV----------- 379
            |:.|    :.::|.|....|......  |....||.:..:|:...:...::|.:           
Human   367 IMPA----KTNNFNVETLKGQAVRKQLWDVAHSVKEKFGKKLYDALLRGEIPDLNDILDRDDLTI 427

  Fly   380 -----------SAPPADQNS----STEPVMCPYR 398
                       |.||...::    ||:|::...|
Human   428 MKRAIFSTQRQSLPPVTTHNMIDDSTDPILSTIR 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIG-ANP_001286547.1 RfaB 1..309 CDD:223515 51/240 (21%)
GT1_PIG-A_like 2..451 CDD:99970 70/359 (19%)
GYS2NP_068776.2 Glycogen_syn 33..658 CDD:283373 70/359 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 628..703
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.