DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIG-A and GYS1

DIOPT Version :9

Sequence 1:NP_001286547.1 Gene:PIG-A / 37020 FlyBaseID:FBgn0034270 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_002094.2 Gene:GYS1 / 2997 HGNCID:4706 Length:737 Species:Homo sapiens


Alignment Length:341 Identity:79/341 - (23%)
Similarity:121/341 - (35%) Gaps:110/341 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 LGLKTVFTDH-SLFGFADLSAALT--NNLLEVNLG------MVNHAICVSHIGKENTVLRARVAK 168
            |.:.|:||.| :|.|....:.|:.  |||...|:.      .:.|..|:.           |.|.
Human   196 LPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYHRYCME-----------RAAA 249

  Fly   169 HRVSVIPNAVDTALFTPDPQQRPSNDIINIVVASRLVYRKGIDLLAGIIPRFKNTPN-INFIIVG 232
            |...|         ||...|       |..:.|..|:.||. |::         ||| :|.    
Human   250 HCAHV---------FTTVSQ-------ITAIEAQHLLKRKP-DIV---------TPNGLNV---- 284

  Fly   233 DGPKRDLLEEIREKTNMQERVQMVGAVEHNRVRDFLVRGHIF--LNTSLTEAYCMAIV---EAAS 292
                        :|.:.....|.:.|....|:::| ||||.:  |:.:|.:.....|.   |.::
Human   285 ------------KKFSAMHEFQNLHAQSKARIQEF-VRGHFYGHLDFNLDKTLYFFIAGRYEFSN 336

  Fly   293 CGLQVVSTSVGGIPEVLPKSLILL----AEPEIDAIYAAILIAIDRHRKSSFKVSPSVGNG---H 350
            .|..|       ..|.|.:...||    :|..:.|.:  |:.|    |.::|.|....|..   .
Human   337 KGADV-------FLEALARLNYLLRVNGSEQTVVAFF--IMPA----RTNNFNVETLKGQAVRKQ 388

  Fly   351 LASDANGKVKRRRRRKVDTPISPTQLPAVS-------------APPADQNSSTEPVMCPYRCNEL 402
            |...|| .||.:..||:...:....||.::             |..|.|..|..|| |.:  |.|
Human   389 LWDTAN-TVKEKFGRKLYESLLVGSLPDMNKMLDKEDFTMMKRAIFATQRQSFPPV-CTH--NML 449

  Fly   403 VETLYNWEDVALRTVK 418
            .::    .|..|.|::
Human   450 DDS----SDPILTTIR 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIG-ANP_001286547.1 RfaB 1..309 CDD:223515 47/210 (22%)
GT1_PIG-A_like 2..451 CDD:99970 79/341 (23%)
GYS1NP_002094.2 Glycogen_syn 31..663 CDD:283373 79/341 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 634..737
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.