DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIG-A and Gys2

DIOPT Version :9

Sequence 1:NP_001286547.1 Gene:PIG-A / 37020 FlyBaseID:FBgn0034270 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_663547.2 Gene:Gys2 / 232493 MGIID:2385254 Length:704 Species:Mus musculus


Alignment Length:288 Identity:53/288 - (18%)
Similarity:101/288 - (35%) Gaps:66/288 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 LGLKTVFTDHSLFGFADLSAA---LTNNL------LEVNLGMVNHAICV-------SHIGKENTV 161
            |.:.||||.|:......|.||   ..|.|      .|.....:.|..|:       :|:....:.
Mouse   196 LPIATVFTTHATLLGRYLCAANIDFYNQLDKFDIDKEAGERQIYHRYCMERASVHCAHVFTTVSE 260

  Fly   162 LRARVAKHRVS-----VIPNAVDTALFTPDPQ--------QRPSNDIIN---------------- 197
            :.|..|:|.:.     |.||.::...|:...:        :....|.:.                
Mouse   261 ITAIEAEHMLKRKPDVVTPNGLNVKKFSAVHEFQNLHAMYKARIQDFVRGHFYGHLDFDLEKTLF 325

  Fly   198 IVVASRLVY-RKGIDLLAGIIPRFK-----NTPNINFIIVGDGPKR------DLLEEIREKTNMQ 250
            :.:|.|..: .||.|:....:.|..     :..|:..::....|.:      :.|:....:..:.
Mouse   326 LFIAGRYEFSNKGADIFLESLSRLNFLLRMHKSNVTVVVFFIMPAKTNNFNVETLKGQAVRKQLW 390

  Fly   251 ERVQMVGAVEHNRVRDFLVRGHIFLNTSLTEAYCMAIVEAASCGLQVVSTSVGGIPEVLPKSLIL 315
            :.|..:......::.|.|:||.|....|:.:...:.|::.|     :.||....:|.|...::| 
Mouse   391 DTVHCLKEKFGKKLYDGLLRGEIPDMNSILDRDDLTIMKRA-----IFSTQRQSLPPVTTHNMI- 449

  Fly   316 LAEPEIDAIYAAI-LIAIDRHRKSSFKV 342
              :...|.|.:.| .|.:..:|....||
Mouse   450 --DDSTDPILSTIRRIGLFNNRADRVKV 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIG-ANP_001286547.1 RfaB 1..309 CDD:223515 44/252 (17%)
GT1_PIG-A_like 2..451 CDD:99970 53/288 (18%)
Gys2NP_663547.2 GT1_Glycogen_synthase_GSY2_like 27..615 CDD:99967 53/288 (18%)
Glycogen_syn 32..657 CDD:283373 53/288 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 620..704
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.